(data stored in ACNUC30630 zone)

EMBL: CP002000.PE15

CP002000.PE15        Location/Qualifiers
FT   CDS_pept        complement(19333..19599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWY4"
FT                   /protein_id="ADJ41841.1"
FT                   /translation="MHARDRELLAALSKVNSKIGSVTVELLTLQPDDAAYASGLRTLGR
FT                   QLVHIGVALTRRAGELDGTELDPVALLNAPDTEAHDRTERSEP"
     gtgcatgctc gtgaccgcga gttgctcgcc gcgctctcga aggtcaactc caagatcgga        60
     agcgtgacgg ttgagctgct gaccctccag ccggacgacg cagcctacgc ctccggcctg       120
     cgcaccctcg gccgccagct cgtccacatc ggtgtagccc tcacccgccg cgccggcgaa       180
     ctcgacggca ccgaactcga tccagttgcc ctgctcaacg cacccgacac agaggcccat       240
     gaccgaacgg agcggtctga accgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page