(data stored in ACNUC30630 zone)

EMBL: CP002000.PE159

CP002000.PE159       Location/Qualifiers
FT   CDS_pept        complement(170101..170688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41985"
FT                   /db_xref="GOA:A0A0H3CVC1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVC1"
FT                   /protein_id="ADJ41985.1"
FT                   /translation="MVTLISAFGLVLAVELPDKTLVATLVLTTRFRGWPVFAGVCAAFA
FT                   VQCVIAVAFGSVLTLLPDVVLSLVVAAMFGLGSFMLLREGFSKADEAGDDASRVGPAPK
FT                   SFLRSAMTSFGVLFAAEWGDASQLATASLAARIGNPFAVGVGAFTALVVVAGLAVFIGA
FT                   KIRSRIKPKLIQRCAGFAFAGFAAFALVQLAF"
     gtggtgacgc tgatcagtgc gttcggcctg gtcctcgccg tggaactgcc ggacaagacg        60
     ctcgtcgcga ccctggtgct gaccacccgt ttccgcggct ggccggtttt cgccggggtg       120
     tgcgccgcgt tcgccgtgca atgcgtcata gcggtcgcgt tcggcagcgt gttgacgctg       180
     ttaccggacg tggtcctttc gctggtcgtc gccgcgatgt tcggcctcgg ctctttcatg       240
     ctccttcgcg agggattcag caaagccgac gaagcgggcg acgacgcgtc gcgtgtcggg       300
     ccggcaccga agtccttcct ccgctccgcg atgacgtcgt tcggcgtgct gttcgccgcc       360
     gagtggggcg atgcctccca gctcgcgacg gcgagtctcg ccgcccggat cggcaacccc       420
     ttcgcggtcg gtgtgggcgc cttcaccgcg ctcgtcgtgg tggccgggct cgccgtgttc       480
     atcggcgcca agatccgcag ccggatcaag ccgaagctga tccagcgctg cgccgggttc       540
     gcgtttgccg gtttcgcggc gttcgccttg gtgcaactgg ccttctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page