(data stored in ACNUC30630 zone)

EMBL: CP002000.PE171

CP002000.PE171       Location/Qualifiers
FT   CDS_pept        186211..186549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41997"
FT                   /db_xref="InterPro:IPR021388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTN1"
FT                   /protein_id="ADJ41997.1"
FT                   /translation="MAAIPELALRQIERWCAQRVPEHLQDRIRVECRPRGRAVTIVELR
FT                   APWSPQAGPDWSEQKIAQLRFDEFGIWSVWWADRNGKWLSYPDAPVASTPPALLAEIDR
FT                   NPGGVFWG"
     atggcggcaa ttccggagct cgcgctgcgg cagatcgaac ggtggtgcgc gcagcgcgtc        60
     cccgagcacc tccaggaccg gatccgcgtc gagtgccggc cgcgcggccg cgcggtgacc       120
     atcgtcgaac tccgcgcgcc gtggtcgccg caggccgggc ccgactggag cgagcagaag       180
     atcgcgcagc tgcggttcga cgagttcggc atctggtcgg tgtggtgggc cgaccggaac       240
     gggaagtggc tgagctaccc ggacgcgccg gtcgccagca caccgcccgc gctgctcgcc       300
     gaaatcgacc gcaaccccgg cggggtgttc tggggctag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page