(data stored in ACNUC30630 zone)

EMBL: CP002000.PE174

CP002000.PE174       Location/Qualifiers
FT   CDS_pept        188047..189336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVD3"
FT                   /protein_id="ADJ42000.1"
FT                   /translation="MDAETLADLLHAQAERDPELRHSLELRAATQSGDVTEAAHRLLDT
FT                   AVTDGNVEYTAKIGAVLDTLQRMLDAGSRADLAPLARRTVDDISEVLEQSGDHAGDLAD
FT                   RLDRAVELYARACAARPPDPEKLADWILEVEFDGPGRPVIDLAEFATALGEPGLKRIKS
FT                   TVDDVLAANGPGHRRDVAERLREQLAEVLGDVDELVAILSAKPPRVDVSLKIVRVLRAA
FT                   GRHSEAIAHAARALTHDKQPSPPEPESETSRRRKEFDAKPDRETFAALREAATADGKWT
FT                   VQRRDALACLRERAAEGVQQADELVRVLLDDGRPDEAWRACVRFGASAELKLELAEQRA
FT                   AEHPAETIPVFREHVDELIERKDPQAYQEAARRLKLLRTLHKRAETADEFTAYLAALVE
FT                   NHRRKTRLITEIRAARIAMPKAVTSPRTPR"
     ttggacgcgg agacgctggc ggacctgctg cacgcccaag ccgagcgcga tcccgagctg        60
     cggcactcgc tcgaactgcg cgcggccacc caatccggtg acgtcaccga ggcggcgcac       120
     cggctgctgg acaccgcggt caccgacggg aacgtcgagt acaccgccaa gatcggcgcg       180
     gtcctcgaca cgctgcagcg gatgctcgac gccggcagcc gcgccgacct cgccccgctg       240
     gcccggcgca cggtcgacga catcagcgag gtgctggagc agtccggcga ccacgccggc       300
     gacctggccg accggctgga ccgggccgtc gagctgtacg cccgcgcgtg cgccgcccgg       360
     ccgccggacc cggagaagct ggccgactgg atcctcgagg tcgagttcga cggccccggc       420
     cgcccggtga tcgacctcgc cgagttcgcg acggcgctgg gtgagccggg gctcaagcgg       480
     atcaagtcca ctgtggacga cgtgctggcg gcgaacgggc cgggccaccg ccgcgacgtg       540
     gccgaacggc tgcgcgagca gctggccgag gtgctcggcg acgtcgacga gctggtggcg       600
     atcctgtcgg ccaagccgcc gcgcgtggac gtcagcctca agatcgtccg ggtgctgcgg       660
     gccgccggac ggcacagtga ggccatcgcg cacgccgccc gcgcgctcac ccacgacaag       720
     cagccgtcgc ctcccgaacc ggaaagcgag acctctcgcc gtcgcaagga attcgacgcc       780
     aaaccggatc gcgagacgtt cgccgccttg cgcgaggccg cgacggccga cgggaagtgg       840
     acggtgcagc gccgggacgc gctggcgtgc ctgcgcgaac gtgccgccga aggggtccag       900
     caggccgacg agctggtccg ggtcctgctc gacgacggcc gtcccgacga agcctggcgc       960
     gcctgtgtcc ggttcggggc gtcggcggag ctcaagctcg agctggccga acaacgggcc      1020
     gccgagcacc cggccgagac gatcccggtc ttccgcgagc acgtcgacga actcatcgag      1080
     cgcaaggacc cgcaggctta ccaggaggcc gctcgccggc tgaagctgtt gcgcaccttg      1140
     cacaagcggg ccgagacggc ggacgaattc accgcttacc tggccgcgct ggtggaaaac      1200
     caccggcgga aaacccggct gatcacggaa atccgggccg ccaggatcgc catgccgaaa      1260
     gccgtaacct cgccgcgcac ccctcgttga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page