(data stored in ACNUC30630 zone)

EMBL: CP002000.PE202

CP002000.PE202       Location/Qualifiers
FT   CDS_pept        217490..218200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42028"
FT                   /db_xref="GOA:A0A0H3CUR4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUR4"
FT                   /protein_id="ADJ42028.1"
FT                   /translation="MNDLDDFRAALRQPPGEPFAEPDLARIMADGTRLRRRRRLLTGTA
FT                   GIAAAAAVVLVVVLAIQLRQPVSAPVAQPPSPAPAVSTTSAAPPAEQPIGDVIGTGIRT
FT                   QSGELVFYARAVDAPELPDIRFGLVAGFRSGTSLQSVLATNEVRGSDRSFGFHATDGGE
FT                   VIRDQLIPVFGYFAGPAAKITTTVHGQTVEAHLAKWTADPKVVIFWFDPAAVPDSAVLT
FT                   PLVAYDTDGKRLTR"
     gtgaacgacc tcgacgactt ccgcgccgcc ctccggcagc cgcccggcga gcccttcgcc        60
     gagcccgacc tggccaggat catggccgac ggcacgcgcc tgcggcgtcg ccgccgcctg       120
     ctgaccggta ccgccgggat cgccgccgcg gccgccgtcg tcctcgtcgt ggtgctcgcc       180
     atccagctgc ggcaacccgt gtccgcgccg gtcgcgcaac cgccgtcgcc ggcaccggcc       240
     gtgtccacga cgtcggctgc gccgcccgcg gagcagccga tcggggacgt catcggcacc       300
     gggatccgga cgcagtccgg cgagctcgtc ttctacgcgc gggccgtcga cgcgccggag       360
     ctgccggaca tccgcttcgg cctggtggcc ggcttccggt ccgggacgtc gctgcagtcc       420
     gtgctggcga cgaacgaggt ccgcggctcc gaccggtcct tcggcttcca cgccaccgac       480
     ggcggcgagg tgatccgcga ccagctcatc ccggtcttcg gctacttcgc cggtccggcg       540
     gcgaagatca cgaccacggt gcacggtcag accgtcgagg cgcacctggc caagtggacc       600
     gccgacccga aggtggtcat cttctggttc gaccccgccg ccgtccccga ctccgccgtc       660
     ctgacgccgc tggtcgcgta cgacaccgac ggcaagcggc tcaccaggta g                711
//

If you have problems or comments...

PBIL Back to PBIL home page