(data stored in ACNUC30630 zone)

EMBL: CP002000.PE210

CP002000.PE210       Location/Qualifiers
FT   CDS_pept        224952..226004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0213"
FT                   /product="acyl-protein synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42036"
FT                   /db_xref="GOA:A0A0H3CXH2"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXH2"
FT                   /protein_id="ADJ42036.1"
FT                   /translation="MSVFTRSTSDREALLLPELVSLTAHHRANSEGYDRILASLGIAPS
FT                   ASFGAIADLPWLPVRMFKTHDLKSVPDSEVFKTLTSSGTTGAGASRIYLDKEAAAAQTK
FT                   QLGATLQEVLGGERLPMLMVDTIGIIKNRRSFSARGAGVLGMANFGRKHTYVLDENDQP
FT                   DVEAVKKFLAEYGDKPFLIFGFTFMVWLYLYEVARDHDLDLSNGILIHSGGWKKLIDRA
FT                   VDNTEFRRRFKEDTGLTRIHNYYGMIEQIGTVFLEGPSGNSLYCPDFADVVIRNPETWE
FT                   EQPVGEPGVIEVVSTLPRSYPGHVLLTEDLGVCNGIDDGDWPGKHFSVLGRLPKAEARG
FT                   CSDTFSGAAA"
     atgagcgtgt tcactcggtc gacgagcgac cgggaggcct tgctgctgcc cgagctcgtg        60
     tccttgaccg cccaccaccg ggcgaactcc gaggggtacg accggatttt ggcctcgctg       120
     gggatcgcgc cttccgcgtc gttcggcgcg atcgccgacc tgccgtggct gccggtgcgg       180
     atgttcaaga cgcacgacct caagtcggtc ccggacagcg aggtgttcaa gacgctgacg       240
     tcgtcgggca ccaccggcgc cggcgcgtca cggatctacc tggacaagga ggcggcggcc       300
     gcgcagacca agcagctggg cgcgacgctg caggaggtcc tcggcggcga gcggctgccg       360
     atgctgatgg tcgacaccat cggcatcatc aagaaccgcc gctcgttctc cgcgcgtggc       420
     gcgggcgtgc tgggcatggc gaacttcggc cggaagcaca cgtacgtgct cgacgagaac       480
     gaccagccgg acgtcgaagc ggtcaagaag ttcctcgccg agtacggcga caagccgttc       540
     ctgatcttcg gcttcacctt catggtgtgg ctgtatctct acgaggtcgc gcgggaccac       600
     gacctcgacc tgtcgaacgg catcctgatc cacagcggtg gctggaagaa gctgatcgac       660
     cgcgcggtcg acaacaccga gttccggcgg cggttcaaag aggacaccgg gctcacccgg       720
     atccacaact actacgggat gatcgagcag atcggcaccg tgttcctcga aggaccgtcc       780
     gggaactcgc tgtactgccc ggacttcgcc gacgtcgtga tccggaaccc ggagacgtgg       840
     gaagaacagc cggtcgggga gccgggcgtg atcgaggtcg tctcgacgct gccgcggtcc       900
     taccccgggc acgtgctgct gaccgaagac ctgggtgtct gcaacggcat cgacgacggc       960
     gactggccgg gaaagcactt ctccgtgctc gggcggctgc cgaaggccga ggcccgcggc      1020
     tgttcggaca cgttctcggg agcggcggca tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page