(data stored in ACNUC30630 zone)

EMBL: CP002000.PE212

CP002000.PE212       Location/Qualifiers
FT   CDS_pept        227258..228226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0215"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42038"
FT                   /db_xref="GOA:A0A0H3CUS3"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS3"
FT                   /protein_id="ADJ42038.1"
FT                   /translation="MTTVEDLPAAGKQPKSARAKILDVVRWVAILLVIGFAAKQLAANW
FT                   GEFWHTLRDVAWESSLLSLVALVAAILVSTWGWQMMVDDLGEPIGYARGAQICLVGSLG
FT                   KYVPGSVWAYLLQMELGRKAGLARARIFTGSLIQLGVGVVSALVVSLLAAPAVFSNSPR
FT                   ALWLFVLIPLGLAMLHPKILTWGTSLVLRILRRPPLQHPLGWRVIGKVFGASTAAWCLQ
FT                   GVHLWLLANSVGTPGLSGFVLCVGAMAVAMTVGTFAFILPSGVGVREVAQVAVLTASGL
FT                   TVGQATAFAVASRVMFTVADLLTAGFAAVAARSVRPAPTPA"
     atgacgacag ttgaggacct gccggctgcg ggcaagcagc cgaagtccgc acgggcgaag        60
     attctcgacg tcgtccggtg ggtggcgatc ctgctggtca tcggcttcgc ggcgaagcag       120
     ctggcggcca actggggcga gttctggcac accctgcgtg acgtcgcgtg ggagtcgtct       180
     ctgctcagcc tggtcgccct ggtcgcggcc atcctggtgt cgacctgggg ctggcagatg       240
     atggtcgacg acctcggcga gccgatcggc tacgcccgcg gcgcgcagat ctgcctggtc       300
     ggctcgctcg gcaagtacgt gccgggctcg gtctgggcgt acctgctgca gatggagctg       360
     ggccgcaagg cgggcctggc ccgcgcccgc atcttcacgg gttccctgat ccagctcggc       420
     gtgggcgtgg tgtcggcgct ggtggtgtcg ctcctggcgg cgcccgcggt gttcagcaac       480
     agcccgcgcg cgctgtggct gttcgtgctc atcccgctcg gcctggcgat gctgcacccg       540
     aagatcctca cctggggcac ctcgctcgtc ctgcggatcc tccgccgccc accgctgcag       600
     cacccgctgg gctggcgggt gatcggcaag gtcttcggcg cctcgacggc ggcgtggtgc       660
     ctgcagggcg tccacctctg gctgctggcc aactcggtgg gcacgccggg cctcagcggc       720
     ttcgtgctgt gcgtgggcgc gatggccgtg gcgatgacgg tgggcacgtt cgcgttcatc       780
     ctccccagcg gcgtcggcgt ccgcgaggtg gcccaggtcg cggtcctgac ggcgagcggc       840
     ctgacggtcg gccaggccac ggcgttcgcg gtggcctccc gggtgatgtt cacggtggcc       900
     gacctcctga cggcgggctt cgcggcggtc gcggcccgct cggtccgccc cgcgcccacc       960
     cccgcctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page