(data stored in ACNUC30630 zone)

EMBL: CP002000.PE216

CP002000.PE216       Location/Qualifiers
FT   CDS_pept        231316..232794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42042"
FT                   /db_xref="GOA:A0A0H3CTS6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTS6"
FT                   /protein_id="ADJ42042.1"
FT                   /translation="MKLEAPDRQLSAEARLGLGVFGTSLALFVVRFLVPRPIAMSNNGD
FT                   GGRVLCGAGITWKGLPEPFVHLAYPPAPGTPPCRPTYLLTQSWLADLAVRIGRLIGLHG
FT                   TLSLVILGLLSSVVAAAASTAIVLGLPHPRRTRLFVAAGLLLVVADSAFFGYFAAILGE
FT                   GAAFLGLLLAVGGLLLTAREGRWSHAGVAVTFVGGVLAVNAKVQTLTILPILALAILLV
FT                   RPGGRRGVRRWAPAVLVIGAIGAVTLFAQQSVEPARAPDGTYTAFPGDDSREINVFNSI
FT                   FLNIVDGKHDTRADLAELGLPPSFAQYAGNGWWHPHPATLDPLYPQYRDRISRRNVVTY
FT                   FATHPGRTLEVLNRAAADQLTARPGYLGSFDQSAGFPPHAQEYRVPVVSWLTGLLAPLG
FT                   LFALVPIWLFVLVRVWWQRRTALGVVLAFLFTVSVTQFGTAALGDGIEGVKHQAVALFT
FT                   ILLAVVLSIPRPTRVSSPALCSSPLNDGPQPTVA"
     gtgaagcttg aggccccgga ccggcagctg agcgccgagg cacggctcgg gctcggggtg        60
     ttcggcacct cgctcgccct gttcgtggtg cggttcctgg tgccgcggcc gatcgcgatg       120
     tccaacaacg gcgacggcgg ccgcgtgctg tgcggtgccg ggatcacctg gaagggcctg       180
     cccgagccgt tcgtccacct cgcctacccg cccgcgccgg gcacgccgcc gtgccgcccg       240
     acgtacctgc tgacgcagag ctggctcgcg gacctggccg tccggatcgg caggctgatc       300
     ggcctccacg gcacgctgag cctcgtcatc ctgggcctgc tgagcagcgt cgtcgccgcg       360
     gcggcgagca ccgcgatcgt gctcggcctg ccgcacccgc gccgcacccg gctgttcgtg       420
     gcggcggggc tcctgctggt cgtcgcggac tcggcgttct tcgggtactt cgcggcgatc       480
     ctcggcgaag gcgcggcctt cctcggcctg ctgctcgccg tcggtggcct gctcctgacc       540
     gcgcgcgagg gccggtggag tcacgcgggc gtggcggtga cgttcgtggg cggcgtcctg       600
     gcggtcaacg ccaaggtcca gacgctgacc atcctgccga tcctcgcgct ggcgatcctg       660
     ctggtccggc ccggcggccg gcgcggcgtg cggcggtggg cgccggcggt gctggtcatc       720
     ggcgcgatcg gcgctgtcac gctcttcgcg cagcagagcg tcgagcccgc gcgagcgccg       780
     gacggcacgt acaccgcgtt cccgggcgac gactcgcgcg agatcaacgt cttcaactcg       840
     atcttcctca acatcgtcga cgggaagcac gacacccggg ccgacctggc cgagctcggg       900
     ctaccgccgt cgttcgcgca gtacgcgggc aacggctggt ggcacccgca cccggcgacg       960
     ctggacccgc tgtacccgca gtaccgcgac cggatcagcc gccgcaacgt cgtgacgtac      1020
     ttcgcgaccc accccggccg gacgctcgaa gtgctgaacc gcgccgccgc cgaccagctc      1080
     accgcgcggc cgggctacct cggcagcttc gaccagagcg ccgggttccc gccgcacgcg      1140
     caggagtacc gggtccccgt ggtgtcgtgg ctgaccggcc tgctcgcccc gctcgggctg      1200
     ttcgcgctgg tgccgatctg gctgttcgtg ctggtcaggg tctggtggca gcgacgaacc      1260
     gcgctcggcg tcgtcctggc gttcctgttc accgtctcgg tgacgcagtt cggcacggcg      1320
     gcgctcggcg acggcatcga aggtgtcaag caccaggccg tcgcgctgtt cacgatcctg      1380
     ctcgccgtgg tcctgtcgat cccgcgtccg acgcgtgtga gttcgcccgc tttgtgttct      1440
     tccccgctga acgacggtcc ccaacctacg gtcgcgtaa                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page