(data stored in ACNUC30630 zone)

EMBL: CP002000.PE232

CP002000.PE232       Location/Qualifiers
FT   CDS_pept        248771..249220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUU1"
FT                   /protein_id="ADJ42058.1"
FT                   /translation="MLIADGGGGGSIADIVNPLSSAGMSAAVKSVTAETQKLVDAAKGG
FT                   GFKITPEGVKPIRDALTELVNDLGDLQYKSFLLDQTPQLGNHPYGLAVAKHDQKSASAA
FT                   DGGATQVLQELREVARQADEALARAAGLYKETESQAFSALQTKQA"
     atgctgatag ctgacggcgg gggcggcggc tcgatcgcgg acatcgtcaa cccgctttcc        60
     tcggccggga tgagcgccgc ggtcaagagc gtcacagccg agacccagaa gctggtcgac       120
     gcagccaagg gcggcgggtt caagatcacc ccggaaggtg tgaagccgat ccgggacgca       180
     ctgaccgaac tggtcaacga cctcggcgac ctgcagtaca agagcttcct gctggaccag       240
     accccgcaac tcgggaacca cccgtacggg cttgccgtcg ccaagcacga ccagaagagc       300
     gcctcggccg ccgacggtgg cgcgactcag gttctccagg agctccgaga ggtcgcgagg       360
     caggcggacg aagcgctcgc cagggccgcg ggcctctaca aggaaaccga gagccaggcc       420
     ttctccgctc ttcagaccaa gcaggcttga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page