(data stored in ACNUC30630 zone)

EMBL: CP002000.PE234

CP002000.PE234       Location/Qualifiers
FT   CDS_pept        249806..251299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42060"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVJ6"
FT                   /protein_id="ADJ42060.1"
FT                   /translation="MTTQQGPRPKTEDKTPQQVQDMAPAERDAYLQQKAEEGVDPGNWL
FT                   FGAVQQWMAQARAKNQAQQMGDKNVKAATQGRDVEYVQGLNPSSADYQGSDHAQLKEYL
FT                   DTNLDVDQVSEVSTAYHEVHQVFDKFAQSMNTAVNASKGTWEGSAAENAQQYFTSLGKW
FT                   SDANSQNAKLASETIYDQGQAAATAKNSMPAPIPFSWKDEFKDWATSNPFSLPDNVDKS
FT                   LQKQKDSQAAHDEAASVMATYDKNLYEAASKQPAFAPPPSFSTGGGSDDPNGTGDKNGI
FT                   NTPSSVNVPGSHPGTTPGGTAQGFVSGSTPGPLGGPAAHTISGPGSTTGSGFVPAGTTT
FT                   PSGFTPSSVPAASTSNSNQQFGGMPPMSPMPMGGGMNFGGDEAYNSKIGGGGGGRGGGF
FT                   GPGGSGAGNATGAGAASGAARPGGIGAAEAAAGRGMGGLGAGASGRGGGMSPGGGLGRG
FT                   QKGEGDEDTEHSRPTYLVEGDPDEVFGTDLRTAPPVIGE"
     atgaccacgc aacagggacc gcggccgaag accgaggaca agacgcccca gcaggtccag        60
     gacatggcgc ccgccgagcg cgacgcctac ctccagcaga aggccgaaga aggcgtcgac       120
     ccgggcaact ggttgttcgg ggcggtgcag cagtggatgg cccaggcccg ggcgaagaac       180
     caggcccagc agatgggcga caagaacgtc aaggccgcca cccagggtcg cgatgtcgag       240
     tacgtgcagg gcctgaaccc gtcgagcgcg gattaccagg gtagtgacca cgcgcagctc       300
     aaggagtacc tggacaccaa cctggacgtc gatcaggttt cggaggtctc gaccgcgtac       360
     cacgaagtgc accaggtctt cgacaagttc gcgcagtcga tgaacaccgc ggtcaacgcg       420
     tccaagggca cctgggaagg cagcgccgcc gagaacgcgc agcagtactt caccagcctc       480
     ggcaagtggt ccgacgccaa ctcccagaac gccaagctgg cctcggaaac catctacgac       540
     cagggtcagg ccgctgccac ggcgaagaac tccatgccgg cccccatccc gttcagctgg       600
     aaggacgagt tcaaggactg ggccacctcg aaccccttca gcctgccgga caacgtcgac       660
     aagtcgctcc agaagcagaa ggacagccag gcggcgcacg acgaggccgc cagcgtcatg       720
     gcgacctacg acaagaacct ctacgaggcc gcctccaagc agcccgcctt cgcgccgccg       780
     ccgagcttca gcaccggcgg gggcagtgac gaccccaacg gcaccggcga caagaacggc       840
     atcaacaccc cctccagcgt gaacgtgccg ggctcccacc cggggaccac gcccggcggc       900
     accgcccagg gcttcgtgtc cggcagcacc cccgggccgc tcggcggccc ggccgcccac       960
     accatctccg ggcctggctc gaccaccggg tccgggttcg tgccggcggg caccaccacg      1020
     ccgtccgggt tcacgcccag ctcggtcccc gccgcgtcga cgtcgaactc gaaccagcag      1080
     ttcgggggga tgccgccgat gagcccgatg ccgatgggcg gcgggatgaa cttcggtggc      1140
     gacgaggcct acaactccaa gatcggcggc ggtggtggcg gccgcggcgg cgggttcggc      1200
     cccggcggct cgggcgccgg caacgcgacg ggcgcgggcg ccgcgtcggg cgcggcccgg      1260
     ccgggcggga tcggcgctgc ggaagcggcc gcggggcgcg ggatgggcgg cctcggtgcg      1320
     ggtgcctccg gtcgcggcgg gggcatgagt cccggtggcg gcttgggccg cggccagaag      1380
     ggcgaaggcg acgaggacac cgagcactcg cgcccgacct acctggtcga gggtgacccc      1440
     gacgaggtct tcggcaccga cctgcgcacg gcgccgccgg tcatcggcga ataa            1494
//

If you have problems or comments...

PBIL Back to PBIL home page