(data stored in ACNUC30630 zone)

EMBL: CP002000.PE238

CP002000.PE238       Location/Qualifiers
FT   CDS_pept        complement(254241..254822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42064"
FT                   /db_xref="GOA:A0A0H3CVV6"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV6"
FT                   /protein_id="ADJ42064.1"
FT                   /translation="MEHMTEPNFTAGDPGQESSPHVVVVGPDGTPVGATQLPSPDSEGD
FT                   HPESVGDLVEEPAKVMRIGTMIKQLLEEVRAAPLDDASRTRVREIHQTSIRELEKALAP
FT                   ELQDELERLVRPFTDDSTPSDAELRIAQAQLVGWLEGLFSGIQTALFAQQMAARVQLEQ
FT                   MRRGLPAGPSGAVGHGHEHGPGISGTGQYL"
     atggagcaca tgaccgagcc gaacttcaca gcgggtgacc cgggccagga atcttcaccc        60
     cacgtggtgg tcgtcggacc ggacggcacg ccggtgggcg ccacccagct gccctccccc       120
     gactccgaag gcgaccaccc cgagtcggtc ggcgacctcg tcgaagagcc ggcgaaggtg       180
     atgcggatcg gcacgatgat caagcagctg ctggaggagg tccgcgcggc cccgctggac       240
     gacgcgtccc gcacgcgcgt gcgcgagatc caccagacgt cgatccgcga gctcgagaag       300
     gcgctggccc cggagctgca ggacgagctg gagcggctgg tccgcccgtt caccgacgac       360
     tcgacgccgt cggacgcgga gctgcggatc gcgcaggccc agctggtggg ctggctggag       420
     gggctgttca gcggaatcca gacggccctg ttcgcccagc agatggccgc ccgcgtccag       480
     ctggaacaga tgcgccgcgg attgccggcg ggcccctcgg gcgcggtcgg ccacggccac       540
     gagcacggcc cgggcatctc gggaacgggc cagtacctct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page