(data stored in ACNUC30630 zone)

EMBL: CP002000.PE246

CP002000.PE246       Location/Qualifiers
FT   CDS_pept        complement(262358..262639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42072"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTV7"
FT                   /protein_id="ADJ42072.1"
FT                   /translation="MCRNITTLRGLQPAATGEEIEAAARQYVRKVTGVQSLSDATREPF
FT                   EAAVAEITEITARLLEQLPERRQPPATVPPLRRPEVQARIAAKALRQL"
     atgtgccgaa acatcaccac cctgcggggg ctccagccgg ccgcgacggg cgaggagatc        60
     gaggccgcgg cccgccagta cgtccgcaag gtcaccggcg tgcagtcgct gtcggacgcc       120
     acgcgcgagc cgttcgaggc ggcggtcgcc gaaatcaccg aaatcaccgc ccggctgctg       180
     gagcagctgc ccgagcgccg ccagccgccg gcgaccgtgc cgccgctgcg ccgccccgag       240
     gtccaggcgc ggatcgccgc gaaggccttg cggcagctct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page