(data stored in ACNUC30630 zone)

EMBL: CP002000.PE268

CP002000.PE268       Location/Qualifiers
FT   CDS_pept        283621..284394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42094"
FT                   /db_xref="GOA:A0A0H3CVY7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY7"
FT                   /protein_id="ADJ42094.1"
FT                   /translation="MTWWHALIVVVAGIWAGTINAVVGSGTLVTFPVLVALGYPPVTAT
FT                   TSNAIGLAPGTLSGAWGYRHELTGYWRQTAKFAVASFFGAIGGTILLLSLPKDAFEAVV
FT                   PVLVGLAVILVIVQPKVSKWVAKRREENGEEHKPGPLLMFFIFLIGIYGGYFTAAQGVM
FT                   LMAVMGMLLSEPLQKLNGVKNVLAAVVNLVAGIIYAFVAPVSWAVVLWLAVGSTAGGFL
FT                   GAKIGRRLPPAVLRGVIVVIGVAAVVQLVVKQFAK"
     atgacgtggt ggcacgccct gatcgtcgtg gtcgccggga tctgggcggg gaccatcaac        60
     gccgtcgtgg ggtcggggac gctcgtcacc ttccccgtgc tcgtcgcgct cgggtatccg       120
     cccgtgaccg ccaccacctc gaacgccatc ggcctcgcgc ccgggaccct cagcggtgcc       180
     tggggttacc ggcacgagct cacgggctac tggcggcaga ccgccaagtt cgcggtcgcg       240
     tccttcttcg gcgccatcgg gggcaccatc ctgctgctgt cgctgccgaa ggacgccttc       300
     gaagccgtcg ttccggtgct ggtggggctg gccgtgatcc tcgtgatcgt gcagccgaag       360
     gtgtccaagt gggtcgccaa gcgtcgcgaa gagaacggcg aagagcacaa acccgggccg       420
     ctgctgatgt tcttcatctt cctcatcggc atctacggcg ggtacttcac cgccgcgcag       480
     ggcgtgatgc tgatggccgt gatggggatg ctgctttcgg agccgctgca gaagctcaac       540
     ggcgtcaaga acgtgctcgc cgccgtcgtc aacctcgtcg ccgggatcat ctacgcgttc       600
     gtcgcgccgg tcagctgggc cgtcgtgctg tggctggccg tcggctcgac cgccggcggc       660
     ttcctcggcg cgaagatcgg ccggaggctg ccgccggcgg tgctgcgcgg cgtgatcgtg       720
     gtgatcggtg tcgccgccgt cgtccagctg gtggtcaagc agttcgcgaa gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page