(data stored in ACNUC30630 zone)

EMBL: CP002000.PE278

CP002000.PE278       Location/Qualifiers
FT   CDS_pept        complement(297543..298586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0281"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42104"
FT                   /db_xref="GOA:A0A0H3CVZ8"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVZ8"
FT                   /protein_id="ADJ42104.1"
FT                   /translation="MPGRLKKFDEFFQRKAAEGGNVVAMARMGAAMRERGELPEAESWY
FT                   RKAAMGGDRVSMTALAHLLAERGAQEEAERWYHEAALAGEPHGMQHLAKSCERRGKRDD
FT                   ARHWYGEAARTGDLPSMAALGRLLREDGKGDEAESWLRQAAEAGFTGAMIDLGVVLRDR
FT                   GQAAEAARWWRSAVQAGDLAATCQLGRQAERLGRPSDAESWYRQGARGGHVEAVTRLGL
FT                   LLHRRGDLEEAETWYLEAAERGDPAAMTNLGVLARNRGDEGEAAAWYRKAAEHGSIPAL
FT                   TNLGHLAEHREDLATAEQWFRRAAETGDVQGMLSLARMLRARGAAHEAELWLARAETVQ
FT                   DEREHQH"
     atgcccggcc ggctcaagaa gttcgacgag ttcttccagc gcaaagccgc ggaaggcggc        60
     aacgtcgtcg ccatggcccg gatgggcgcg gcgatgcgcg agcgcggaga gctgcccgag       120
     gccgagtcgt ggtaccgcaa ggccgccatg ggcggcgacc gcgtctcgat gaccgcgctg       180
     gcccacctcc tcgccgagcg cggcgcgcag gaggaggccg agcgctggta ccacgaggcc       240
     gcactggccg gcgagccgca cgggatgcag cacctcgcca agtcctgcga gcggcgcggc       300
     aagcgcgacg acgcccggca ctggtacggc gaggcggcgc ggaccggcga cctgccgtcg       360
     atggccgcgc tcgggcggct gctgcgcgaa gacggcaagg gcgacgaggc cgagtcgtgg       420
     ctgcgccagg ccgcggaagc gggcttcacc ggcgcgatga tcgacctggg cgtcgtgctg       480
     cgcgaccgcg gtcaggccgc cgaggcggcc cgctggtggc gctccgccgt gcaggccggc       540
     gacctcgcgg ccacctgcca gctcggcagg caggccgaac ggctcggccg gccgagcgac       600
     gccgaatcgt ggtaccgcca gggcgcgcgc ggcggccacg tcgaggcggt cacccggctc       660
     gggctgctgc tgcaccgccg cggcgacctc gaggaggccg agacctggta cctcgaagcc       720
     gccgagcgcg gcgacccggc ggcgatgacc aacctcggcg tgctggcccg caaccgcggc       780
     gacgaggggg aagccgccgc ctggtaccgc aaggccgccg agcacggcag catcccggcg       840
     ctcaccaacc tcggccacct cgccgagcac cgcgaggacc tggcgacggc cgagcagtgg       900
     ttccgccggg ccgccgagac cggcgacgtc cagggcatgc tgagcctggc gcgcatgcta       960
     cgggcgcggg gtgccgccca cgaggccgag ctgtggctgg cccgcgcgga gaccgtgcag      1020
     gacgagcggg agcaccagca ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page