(data stored in ACNUC30630 zone)

EMBL: CP002000.PE314

CP002000.PE314       Location/Qualifiers
FT   CDS_pept        327784..328992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0317"
FT                   /product="esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42140"
FT                   /db_xref="GOA:A0A0H3CVS3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS3"
FT                   /protein_id="ADJ42140.1"
FT                   /translation="MHLSNIRLDSPITMSVVIAVTLLAIIAIPLFWERWKRKLLWRTVT
FT                   ILCAVVSIVVTTGLAGNLIGGFFPTLGSLLGTGAYAANTIDAETSANGENLEVVREVGA
FT                   AHAKEGKGTVAHMKVTGRRTKLTRDVTVYLPPQHFEPAYRNLRFPVIEWIPNYPSGPEV
FT                   VTDGYKLPEHLDAAIAKRVLPPVVVIMPDPTGVPKIGHDTECVDEVDGTANDTYLTADL
FT                   REWALQKLGVSADRKAWTFAGWSSGGYCAMNLVTRHPQWYGQAVSVSGYDRAQMDAETE
FT                   NLYKGRQDVDDANNVGITVRLHPSPVDILAIWGENEKFESAAAELIRAGVRPPVRFSSW
FT                   RVPDAGHNMNTFKSQIPEILTWIGAHTTPPATAGRQVETTGGVQPWPLPRSGAAGGLTD
FT                   ADQ"
     atgcacctca gcaacatccg gctcgactcg ccgatcacga tgagcgtcgt gatcgccgtg        60
     acgctgctgg ccatcatcgc catcccgttg ttctgggagc ggtggaaacg caagctgctg       120
     tggcgcaccg tcaccattct ttgcgcggtc gtctccatcg tcgtcaccac cggcctggcc       180
     ggcaacctga tcggcgggtt cttcccgaca ctcggttcgc tgctcggcac cggcgcctac       240
     gcggccaaca ccatcgacgc cgagacgagc gcgaacggcg agaacctcga ggtcgtccgg       300
     gaggtgggtg cggcgcacgc caaggagggc aagggaaccg tcgcccacat gaaggtgacc       360
     ggccggcgca ccaagctcac ccgcgacgtg acggtgtacc tcccgccgca gcacttcgaa       420
     ccggcctacc ggaatctccg gttcccggtg atcgagtgga tcccgaacta cccgtccggg       480
     cccgaggtcg tcaccgacgg gtacaagctc ccggaacacc tcgacgcggc gatcgccaag       540
     cgcgtgctgc ccccggtcgt ggtgatcatg ccggacccca cgggcgtccc gaagatcggt       600
     cacgacaccg agtgcgtcga cgaggtcgac ggcaccgcga acgacacgta cctgacggcg       660
     gacctgcggg agtgggcgct gcagaagctg ggcgtgtcgg cggaccggaa ggcctggacc       720
     ttcgccggct ggtcgtccgg cggctactgc gcgatgaacc tggtgacccg ccacccgcag       780
     tggtacggcc aggcggtcag cgtcagcggc tacgaccgtg cccagatgga cgccgagacg       840
     gagaacttgt acaagggccg tcaggacgtc gacgacgcca acaacgtcgg catcacggtc       900
     cgcctccacc cgtccccggt ggacattctg gccatctggg gcgagaacga gaagttcgag       960
     agcgcggcgg ccgagctgat ccgcgccggc gtccggccac cggtccggtt ttcgtcgtgg      1020
     cgggtgccgg acgcgggcca caacatgaac accttcaagt cccagatccc cgagattctc      1080
     acctggatcg gcgcccacac gaccccgccc gccacggcgg gccgtcaggt cgagaccacc      1140
     ggcggggtgc agccgtggcc gctgccccgc tcaggcgcgg cgggcgggct gacggacgcc      1200
     gaccagtga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page