(data stored in ACNUC30630 zone)

EMBL: CP002000.PE316

CP002000.PE316       Location/Qualifiers
FT   CDS_pept        330086..330799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42142"
FT                   /db_xref="GOA:A0A0H3CU29"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU29"
FT                   /protein_id="ADJ42142.1"
FT                   /translation="MVHAKGARIRVRGLQPAQVLAGLAGIAFLVVGIIGFSRTGFGNFA
FT                   GHHDAGFWRFSANPLMSLVRVVTGVVGLLFAFGSGRARAFGWLLFIGYGLLFVWGLMID
FT                   GLISTNPFANAGNPLDIGRADTWLHLGIAALGLLIAVLPARRTILLPEDETVDEPVVAE
FT                   QRTEVIDRTGRTDRTDRVGPVDRTDRIEADRVHTDRVNSDQVTEEPRRRSFLRRDHKGR
FT                   GPEVTREERPPGLAH"
     atggttcacg cgaaaggcgc acgcatccgg gtccgaggcc tgcagccggc gcaggtgctg        60
     gccggactgg ccgggatcgc gttcctcgtc gtcggcatca tcggattctc aaggaccggc       120
     ttcggcaact tcgccgggca ccacgacgcc gggttctggc ggttctccgc caacccgctg       180
     atgagcctgg tccgcgtcgt gaccggcgtc gtcggcctgc tgttcgcgtt cggctcgggc       240
     cgcgcgcggg cgttcggctg gctgctgttc atcggctacg gcctgctgtt cgtgtggggc       300
     ctgatgatcg acggcctcat ctcgaccaac ccgttcgcca acgccggcaa cccgctcgac       360
     atcgggcgcg ccgacacgtg gctgcacctc gggatcgccg cgctcggcct gctgatcgcg       420
     gtgctgccgg cccgccgcac catcctgctg cccgaagacg agacggtcga cgagccggtg       480
     gtcgccgagc agcgcaccga ggtgatcgac cggaccggcc gcacggatcg gaccgaccgc       540
     gtcggcccgg tcgaccgcac tgaccggatt gaagccgacc gggtccacac cgaccgggtc       600
     aactccgacc aggtcaccga agaaccgcgt cgccggtcgt tcctgcgtcg tgaccacaag       660
     gggcgaggcc cggaggtcac tcgtgaagag cgtccgccgg gcctcgccca ctag             714
//

If you have problems or comments...

PBIL Back to PBIL home page