(data stored in ACNUC30630 zone)

EMBL: CP002000.PE32

CP002000.PE32        Location/Qualifiers
FT   CDS_pept        complement(38752..39288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41858"
FT                   /db_xref="GOA:A0A0H3CUB5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUB5"
FT                   /protein_id="ADJ41858.1"
FT                   /translation="MSRATAQAVETADKLVTEGVKQGRRAQKKLAKKTELTRKELKKSS
FT                   KAARQEALARLSELRKPGRKAKKAAIKAAKAAGESKRRGKKDFKAAKKDFYAALSEAKS
FT                   AAKGTRSRRKWPWLLGLVVVGAGAAYALRSKQEPPVAPAPPKATPPAPKPAEPAKPTAQ
FT                   ANGKAPSAAPAEKKN"
     atgtcccggg cgacagccca ggccgtcgag accgccgaca aactcgtcac cgagggtgtc        60
     aagcaggggc ggcgcgcgca gaagaagctc gcgaagaaga cggaactgac ccgcaaggag       120
     ctcaagaaga gctcgaaggc cgctcgccag gaggcgctcg cgcgcctgtc cgagctgcgc       180
     aagccgggtc gcaaggcgaa gaaggccgcc atcaaggccg cgaaggcggc cggcgagtcg       240
     aagcgccgcg gcaagaagga cttcaaggcg gcgaagaagg acttctacgc cgctctgtcc       300
     gaggccaagt cggccgccaa gggcacccgc agccggcgca agtggccgtg gctgctgggc       360
     ctggtcgtgg tcggcgcggg cgccgcctac gcactgcggt cgaagcagga gccgccggtc       420
     gccccggcgc ccccgaaggc caccccgcct gcgccgaagc ccgccgaacc ggcgaagccg       480
     accgcgcagg cgaacggcaa ggcgccgtcc gcggcgcccg ccgaaaagaa gaactga          537
//

If you have problems or comments...

PBIL Back to PBIL home page