(data stored in ACNUC30630 zone)

EMBL: CP002000.PE320

CP002000.PE320       Location/Qualifiers
FT   CDS_pept        complement(334238..334780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42146"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXU8"
FT                   /protein_id="ADJ42146.1"
FT                   /translation="MTEHMIPVAAPPRLTAPRTDPAPVADERRALTESLDYYRRTFELK
FT                   CAGLDPAQLAERSVPPSTLTLHGLLRHLTGCERWWFRIQFTGEDVPNLYYSDDDPEQDF
FT                   TDLGGDVDEAFSLWHAECARSREIVAASSLEQTGIRRSTGEPFTLRWLMLRMIGEYARH
FT                   IGQADLIRERIDGATGE"
     atgaccgaac acatgatccc ggtggcggcc ccgccccgcc tgacggcccc cagaaccgac        60
     ccggcgccgg tcgcggacga gcgccgggcc ctgaccgaga gcctcgacta ctaccggcgc       120
     acgttcgagc tgaagtgcgc cggtctggac ccggcgcagc tggccgaacg ctcggtacca       180
     ccgtccacat tgaccctgca cggactgctg cggcacctca cgggctgcga acgctggtgg       240
     ttccggatcc agttcacggg cgaggacgtc ccgaacctct actactccga cgacgacccg       300
     gagcaggact tcacggacct gggtggtgat gtcgacgagg cgttctcgtt gtggcacgcc       360
     gaatgcgcgc gctcccggga gatcgtcgcg gcgagctcac tggagcagac cggcattcgc       420
     cgcagcaccg gcgaaccgtt caccctgcgc tggctgatgc tgcgcatgat cggcgagtac       480
     gcgcgccaca tcggccaggc cgacctgatc cgcgagcgga tcgacggcgc gaccggcgaa       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page