(data stored in ACNUC30630 zone)

EMBL: CP002000.PE339

CP002000.PE339       Location/Qualifiers
FT   CDS_pept        357852..358886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0343"
FT                   /product="ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42165"
FT                   /db_xref="GOA:A0A0H3CVU1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011391"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR039065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU1"
FT                   /protein_id="ADJ42165.1"
FT                   /translation="MGETVAGIVANPASGRDIRRLVAQASVFPTAEKANMVQRLLAAFA
FT                   VTGLDRALVSTDLGGISAAVLRALGRGGSWPKVDFCEDDALTGTAADTTNAVRRMVEAG
FT                   AGVIVVLGGDGTARVAAAACEDVPLLALSTGTNNAFPQMREATVAGLAAGLIATGQIDP
FT                   DLVTHRVSVLEVVTKARREIALVDVCVSLSRHIGARALWDPSSLTELYCTFAEPDGIGL
FT                   SSVPGQLCPSPRSSPDGVALQLGPVGETPYVVHAPIAPGLVRPVGVRGWGLLRPGVRVE
FT                   LAAAGGVIALDGERELELKTGESAFVELKPDGPWVVDVRAAMAEAARKGLLRADTELGK
FT                   ERRR"
     gtgggtgaaa cggtggcggg gatcgtcgcg aaccccgcat cggggcggga catccgccgg        60
     ctggtcgcgc aggcgtcggt gttccccacc gcggaaaagg cgaacatggt ccagcggctg       120
     ctggcggcgt tcgccgtcac cgggctcgac cgggccctcg tctcgaccga cctgggcggg       180
     atttccgccg cggtcctgcg cgcgctcggc cgcggtggct cctggccgaa ggtcgacttc       240
     tgcgaggacg acgccctcac cggcaccgcc gccgacacga cgaacgccgt gcgtcgcatg       300
     gtcgaggccg gcgccggggt catcgtcgtc ctcggtgggg acgggaccgc ccgggtcgcc       360
     gccgcggcct gcgaggacgt gccgctgctc gccctctcca ccgggaccaa caacgccttc       420
     ccgcagatgc gggaggcgac cgtcgccggc ctggccgccg ggctgatcgc caccgggcag       480
     atcgatcccg acctcgtcac ccaccgcgtc agcgtgctcg aggtcgtcac gaaagcacgc       540
     agggagatcg cgctcgtcga cgtctgcgtg tcgctgagca ggcacatcgg ggcgcgggcg       600
     ctgtgggacc cctcgtcgct caccgagctg tactgcacct tcgccgagcc ggacggcatc       660
     ggcctctcga gcgttcccgg ccaactgtgc cccagcccgc ggtcgagccc ggacggcgtc       720
     gcgctgcagc tcgggccggt cggggagacg ccgtacgtcg tgcacgcgcc gatcgcgccc       780
     gggctcgtcc ggccggtcgg cgtgcgcggc tgggggctcc tgcgacccgg cgtgcgcgtc       840
     gaactcgctg ccgcgggcgg agtcatcgcg ctcgacggcg agcgcgagct cgagctgaag       900
     accggggaga gcgcgttcgt cgagctcaag ccggacgggc cgtgggtcgt cgacgtgcgg       960
     gcggcgatgg cggaggcggc gcggaaagga ctgttgcgcg cggacaccga actggggaag      1020
     gagcgccgaa gatga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page