(data stored in ACNUC30630 zone)

EMBL: CP002000.PE36

CP002000.PE36        Location/Qualifiers
FT   CDS_pept        complement(41374..41640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0038"
FT                   /product="putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41862"
FT                   /db_xref="GOA:A0A0H3CTB0"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTB0"
FT                   /protein_id="ADJ41862.1"
FT                   /translation="MPKSKVRKKTAYTPPADRRTPVKVRAAGPTGLAWKIPMFGLMLIG
FT                   LVWLLVNYIAGDKISWMADLGNWNFAGGFALMIAGLLMTMRWR"
     atgcccaagt ccaaggtccg caagaagacc gcgtacaccc cgcccgccga ccggcgcacg        60
     ccggtgaagg tgcgagccgc aggcccgacc ggcctggcct ggaagatccc gatgttcggg       120
     ctgatgctga tcggcctggt gtggctgctg gtcaactaca tcgccgggga caagatctcc       180
     tggatggccg acctgggcaa ctggaacttc gccggcgggt tcgcgctgat gatcgcgggt       240
     ctgctcatga ctatgcgctg gcgttga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page