(data stored in ACNUC30630 zone)

EMBL: CP002000.PE364

CP002000.PE364       Location/Qualifiers
FT   CDS_pept        complement(381384..381614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DCG0"
FT                   /protein_id="ADJ42190.1"
FT                   /translation="MTGPEHYKIAEKLIAGGIQRVTPWGDTDWVAPTPEVVARAQVHAT
FT                   LALAAATASGAWAEMSNDESRSWDQAIGVER"
     atgactggac ccgagcacta caagatcgcc gagaagctga tcgccggagg cattcagcgg        60
     gtgactccgt ggggcgatac ggactgggtt gcgccgaccc cggaggtcgt agcacgtgcc       120
     caagtgcacg cgacgctggc gctggccgcc gcgaccgcgt ccggagcgtg ggcggagatg       180
     tccaacgacg aatcgcggtc gtgggaccag gcgatcgggg tggagcggtg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page