(data stored in ACNUC30630 zone)

EMBL: CP002000.PE370

CP002000.PE370       Location/Qualifiers
FT   CDS_pept        complement(384050..384307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY07"
FT                   /protein_id="ADJ42196.1"
FT                   /translation="MSTPARTARRKIEMDAAELDFDYFADTTSLAGDGVLVDDFDNVAE
FT                   LVDLYAEIAEIEEALAELERPVAQVIALPTATPRPLGEVA"
     atgagcaccc ccgcacgcac tgcccgtcgc aagatcgaga tggacgctgc cgagctggac        60
     ttcgactatt tcgccgacac caccagcctc gccggtgacg gcgtcctggt ggacgacttc       120
     gacaacgttg ctgagctggt cgacctctac gcggagatcg cggagatcga ggaagcgctg       180
     gccgagctgg agcgcccggt ggcccaggtg atcgcgctgc cgaccgcgac gcctcgcccg       240
     ctgggggagg tggcctga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page