(data stored in ACNUC30630 zone)

EMBL: CP002000.PE373

CP002000.PE373       Location/Qualifiers
FT   CDS_pept        387980..388507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42199"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW89"
FT                   /protein_id="ADJ42199.1"
FT                   /translation="MLAAVVAGLVLMVTSTTMLAVNAAEQAAIERQQQAQAHEQAVARI
FT                   LPRTPASMVNFLAERIARPTPTAVADACFVFSPAAQRQLADAHGGEDCPGAIQALAAQV
FT                   VDPSGYVNHLWLPGRATQPGPAGTLTVDACVLDFGGIAGWSGPDPGPQIGHLTLTQQHG
FT                   EGQLITRYTRCS"
     gtgctcgccg ccgtcgtagc cggcctggtg ctgatggtga cgtccacgac gatgctggcg        60
     gtgaacgcgg ccgagcaggc cgcgatcgag cggcagcagc aagcccaggc acacgagcag       120
     gccgtggcgc ggatcttgcc gcggacaccg gccagcatgg tgaacttcct ggccgagcgc       180
     atcgcccggc ccactcccac ggcggtcgcc gacgcatgct tcgtgttcag cccggccgcg       240
     cagcgccagc tggccgacgc ccacggcggg gaagactgcc ccggagccat ccaggcactc       300
     gctgctcaag tcgtcgaccc cagcggctac gtcaaccacc tgtggctccc cggtcgggca       360
     acccaacccg gcccggccgg cacgctcacc gtggacgcct gcgtgctcga cttcggcggc       420
     atcgccggct ggtccggccc tgatcctggg ccacagattg ggcatctgac cctgacccag       480
     cagcacggcg aaggccagct catcacgaga tatacgcgct gctcttga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page