(data stored in ACNUC30630 zone)

EMBL: CP002000.PE393

CP002000.PE393       Location/Qualifiers
FT   CDS_pept        408205..409056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42219"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWB0"
FT                   /protein_id="ADJ42219.1"
FT                   /translation="MDPDFLPDAIDLDRPNIARIYDWALGGSANWAIDRQYGEQAVQAF
FT                   PLAKALARGNRDFLGRAVRYCLAEGITQFLDLGSGIPTAGNVHEVADDYADDSRCVYVD
FT                   HEPVAVAHGRMLLEEAGDPERHAVLHADLRDAEEVWEAALATGVLDPDRPICLLTVAVL
FT                   HFLPDVTGVRQAIRDYRTLLAPGSAYVLSHATESGVEGEELEQIRKLVKLSERSSSPAV
FT                   SRSLDEIAAFFGTFDVVEPGIVPVGEWRPEPGAATVRLASVVGGVGRKPGGRNDDAGPR
FT                   SA"
     gtggaccccg acttccttcc cgatgccatc gatctcgacc gcccgaacat cgcgcggatc        60
     tacgactggg ccctgggcgg cagcgcgaac tgggcgatcg accggcagta cggcgagcag       120
     gcggtgcagg cgttcccgct ggcgaaggcc cttgcgcggg gcaaccggga cttcctcggc       180
     cgggccgtgc gctactgcct cgccgagggc atcacgcagt tcctcgacct cggctccggt       240
     atcccgaccg cgggcaacgt gcacgaggtc gccgacgact acgccgacga cagccggtgc       300
     gtctacgtcg accacgagcc cgtggccgtc gcgcacgggc ggatgctgct cgaagaagcc       360
     ggcgatcccg agcgccacgc ggtgctgcac gccgacctgc gggacgccga agaggtctgg       420
     gaagccgcgc tcgccaccgg cgtgctcgac ccggaccggc cgatctgcct gctgaccgtg       480
     gcggtgctgc acttcctgcc ggacgtcacc ggcgtccgcc aggccatccg cgactaccgg       540
     acgctcctgg caccgggttc ggcgtatgtg ctttcgcacg ccaccgaatc cggcgtcgaa       600
     ggcgaagagc tggagcagat ccggaagctc gtgaagctgt ccgaacggtc gagctcaccc       660
     gcggtttccc ggtccctcga cgagatcgcg gcgttcttcg gtaccttcga cgtcgtcgag       720
     cccgggatcg tgcctgtggg agagtggcgc ccggagcccg gcgccgccac ggtccgcctc       780
     gcgagcgtgg tcggcggtgt cggccgcaag cctggaggac gcaatgacga cgcaggaccc       840
     cgaagcgcct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page