(data stored in ACNUC30630 zone)

EMBL: CP002000.PE407

CP002000.PE407       Location/Qualifiers
FT   CDS_pept        419744..420301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0411"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42233"
FT                   /db_xref="GOA:A0A0H3CVB0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB0"
FT                   /protein_id="ADJ42233.1"
FT                   /translation="MATVHAGMSMSLDGFVADRHGGTARLSDPAASSGSEWMTDLIRET
FT                   GAVVLGRRSFAMAEDPDWYAGNYEFQVPIFVVTHTPPAVLPAQNENLTFTFVTDGIASA
FT                   VKQARAAAGDRAVKVIGASVVRQAVRARVADELHVLLAPVLLGAGLPLFGDPDLDGVAL
FT                   RRLGVREVGPITELRFTLLNPL"
     atggccacgg tgcacgcggg catgagcatg tcgctggacg gcttcgtcgc cgatcgccac        60
     ggcggcacgg cccggctgtc cgaccccgcc gcgtcgagcg gcagcgagtg gatgaccgac       120
     ctgatccggg agaccggcgc ggtcgtcctc ggccgccggt cgttcgcgat ggccgaggac       180
     ccggactggt acgccggcaa ctacgagttc caggtgccga tcttcgtcgt cacccacacg       240
     ccgccggccg tgctgcccgc gcagaacgag aacctcacct tcaccttcgt gaccgacggg       300
     atcgcttcgg cggtcaagca ggcgagggcg gccgcggggg accgggcggt caaggtgatc       360
     ggcgcgagcg tggtccggca ggccgtgcgg gcccgggtgg ccgacgagct gcacgtcctg       420
     ctcgccccgg tgctgctggg tgccggactg ccgttgttcg gcgaccccga tctcgacggc       480
     gtcgcgctgc gccggctcgg cgtgcgtgag gtcgggccga tcaccgaact ccgcttcacg       540
     ctgcttaacc ccctatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page