(data stored in ACNUC30630 zone)

EMBL: CP002000.PE450

CP002000.PE450       Location/Qualifiers
FT   CDS_pept        457852..458364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42276"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYB6"
FT                   /protein_id="ADJ42276.1"
FT                   /translation="MSLDELIQSTLDSAGLEYDKRGPGKYFVTLPGTKKLQTNAWLVDG
FT                   DHAFSVEAFVCRRPDESHEDVYRFLLQRNAKLYGVHYTVDSLGDIYLVGRFGKETMSAD
FT                   ELDKVLGQVLEAADGDFNTLLEIGFATSIKREWDWRVSRGESLANLQAFKHLVAPGKPH
FT                   EPGLTES"
     gtgagcctgg acgagctgat ccagtctact ttggactcgg cggggctgga gtacgacaag        60
     cgcgggccgg gcaagtactt cgtcacgctg ccggggacga agaagctgca gacgaacgcg       120
     tggctggtcg acggcgacca cgcgttttcg gtggaggcct tcgtctgccg ccgccccgat       180
     gagtcccatg aggacgttta ccggttcctg ttgcagcgca acgcgaagct ctacggcgtt       240
     cactacacag tggacagtct cggggacatc tacctggtcg gccggttcgg caaggagacg       300
     atgagcgccg acgagctcga caaggtgctc ggccaggtgc tggaagcggc cgacggcgac       360
     ttcaacaccc tgctcgagat cggcttcgcg acgtcgatca agcgcgagtg ggactggcgc       420
     gtctcccgcg gggaatccct ggccaacctc caggcgttca agcacctcgt cgcgcccggg       480
     aagccgcacg aaccgggctt gaccgagtcg tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page