(data stored in ACNUC30630 zone)

EMBL: CP002000.PE499

CP002000.PE499       Location/Qualifiers
FT   CDS_pept        505575..505856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42325"
FT                   /db_xref="GOA:A0A0H3CWB6"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWB6"
FT                   /protein_id="ADJ42325.1"
FT                   /translation="MSDVKADHLPRDLTLYLLARFVLVGVIAWALSLTGVPLLVALVIG
FT                   LVVGLPLGLLLFRPLNARVTAGLAKRNEKRARARAELRAQLRGEGQPE"
     gtgagcgacg tgaaggccga ccacctgccc cgtgacctga cgctgtacct gctggcgcgg        60
     ttcgtgctgg tcggggtgat cgcgtgggcg ctgtccctga ccggggtgcc gctgctggtc       120
     gcgctggtga tcggcctggt cgtcggcttg ccgctcggcc tgctgctgtt ccgcccgctc       180
     aacgcccgcg tgaccgccgg gctggccaag cgcaacgaaa agcgggcccg cgcccgggcc       240
     gagctgcgcg cgcagctgcg cggggaggga cagcccgagt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page