(data stored in ACNUC30630 zone)

EMBL: CP002000.PE54

CP002000.PE54        Location/Qualifiers
FT   CDS_pept        complement(59368..59829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0056"
FT                   /product="FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41880"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV25"
FT                   /protein_id="ADJ41880.1"
FT                   /translation="MPELVVQLTRVGFLVLLWLFVFAALRVVRSDLYAASGMRVQVPTF
FT                   GRKKEKKPRNSKSPQQLLVTHGALAGTRIALDGRPILIGRADDSTLVLDDDYASTRHAR
FT                   IAQRGEDWYVEDLGSTNGTYLDRAKVTAPLRVPLGVPIRIGKTVIELRP"
     gtgccagagc tggtcgtaca actcaccagg gtgggcttcc tcgtgctgct ctggctcttc        60
     gtgttcgccg cgctcagagt cgtccgctcg gacctctacg cggcgtccgg catgcgcgtc       120
     caggtgccga ccttcgggcg caagaaagag aagaagccgc gcaacagcaa gtccccgcag       180
     cagctgctcg tcacgcacgg cgcgctggcg gggacgcgca tcgcgctgga cggccggccg       240
     atcctgatcg gccgggccga cgactccacg ttggtgctcg acgacgacta cgcgtcgacc       300
     cggcacgcgc ggatcgccca gcgcggcgag gactggtacg tggaagatct gggctcgacg       360
     aacgggacgt atctcgaccg ggctaaggtc actgcacccc tccgggtccc gctcggagtc       420
     cccatccgga tcggcaagac ggtgatcgag cttcgcccat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page