(data stored in ACNUC30630 zone)

EMBL: CP002000.PE544

CP002000.PE544       Location/Qualifiers
FT   CDS_pept        555505..557460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0550"
FT                   /product="exopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42370"
FT                   /db_xref="GOA:A0A0H3CWF0"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWF0"
FT                   /protein_id="ADJ42370.1"
FT                   /translation="MTTPPSQAPAAPLVDLQRLFVAIRRRKRVWLATALLGLIAGAALA
FT                   FLLPAPPTAVAKVIVVHQDDSPTDSGTLMRTDVAVLQTAQIAGAALKKLGSTDSPEDFM
FT                   KNYAGLGVTNNVLQITVKAKSNEEAVARAQALAETFIADHVKRSQAAAAAQSQAILDQR
FT                   KNAQDELSKVEQQIVAEEGKGRQASQPALENLYSRRAALTAQITDFTSRAQQAGIGSPQ
FT                   VAAGTQVVDAARALPKAFLKTTATNAGIGFALGLALGLALVAVGAVSRDRPVLRREIST
FT                   HLGASVIAQLPSKLRGPARLWRRSRAVSERKRVATTLVRLIKQEPRGVSLLELGAPKVA
FT                   AALGLDIAEELAADGAASVVDDLPGEDVRKLAQETKSDVSVVGAGDPPGTPEERRVGIG
FT                   TVSPGTAWTDLEHLGKETVLVVKSGHANTLWLHTVARQLADQEIPIIGVVLVDPDPRDK
FT                   SDGTLWDGLHTALRGRGRPAAAAQPAPAEREDHLDELVARVVERVTTTEHPTRRFTPIR
FT                   PVLPPALATPRPPASPLPPPGSVSVPDHLNAPTKKFAPVKPPKRPSPFKRDHAEPNHKG
FT                   ELNADLEPEKSTVTTGASPRAGGSATRTPEKSTVTTGALPRAGGSATQTPEKSAVTTGA
FT                   SPRAGGSATQTPEKSA"
     gtgacgactc ctccttcgca ggccccggcc gccccgctcg tcgacctgca gcggctgttc        60
     gtcgcgatcc gccgtcgcaa gcgggtctgg ctggccaccg cgctcctcgg gctcatcgcc       120
     ggcgcggcgc tggccttcct gctgcccgcg ccgccgaccg cggtcgccaa ggtgatcgtc       180
     gtccaccagg acgactcgcc gaccgacagc ggcaccctga tgcgcaccga cgtcgccgtg       240
     ctgcagacgg ctcagatcgc cggggccgcg ctgaagaagc tgggcagcac cgattcgccc       300
     gaagacttca tgaagaacta cgcgggcctc ggcgtgacca acaacgtcct gcagatcacc       360
     gtcaaggcca agagcaacga agaggccgtg gcgcgggccc aggcgctggc cgaaacgttc       420
     atcgccgacc acgtcaagcg cagccaggcg gccgcggccg cccagtcgca ggccatcctc       480
     gaccagcgca agaacgccca ggacgagctg agcaaggtcg agcagcagat cgtcgccgag       540
     gagggcaagg gccgccaggc cagccagccc gcgctcgaaa acctctacag ccgccgggcc       600
     gcgctcaccg cgcagatcac ggacttcacc tcgcgcgccc agcaggccgg catcggcagc       660
     ccgcaggtcg ccgcgggcac ccaggtcgtc gacgcggccc gcgcgctgcc caaggcgttc       720
     ctcaagacca ccgcgaccaa cgccggcatc gggttcgccc tcggcctggc tctcgggctc       780
     gcgctcgtcg ccgtcggcgc ggtttcgcgc gaccggccgg tgctgcgccg cgaaatctcg       840
     acgcacctcg gcgcgtccgt gatcgcgcag ctgccgtcga agctgcgcgg gccggcccgg       900
     ctgtggcggc gctcgcgcgc ggtctccgaa cgcaagcgcg tcgccacgac gctggtccgc       960
     ctgatcaagc aggagccgcg cggggtgtcg ctgctggagc tcggcgcccc gaaggtcgcc      1020
     gccgcgctcg gcctggacat cgccgaggag ctggccgccg acggcgccgc gagcgtcgtc      1080
     gacgacctgc cgggcgagga cgtccgcaag ctcgcgcagg agaccaagag cgacgtctcc      1140
     gtggtcggcg ccggcgaccc gccggggacg ccggaggagc gccgcgtcgg catcggcacg      1200
     gtgtcgccgg gcacggcgtg gaccgacctg gagcacctcg gcaaggagac cgtgctggtc      1260
     gtgaagtccg ggcacgcgaa cacgctgtgg ctgcacacgg tcgcccggca gctcgccgac      1320
     caggagatcc cgatcatcgg cgtcgtgctg gtcgatccgg acccgcgcga caagtccgac      1380
     ggcacgttgt gggacggcct gcacacggcc ctgcgtggcc gcggccgccc ggccgccgcg      1440
     gcgcagccgg ccccggccga gcgcgaagac cacctggacg agctggtcgc ccgcgtcgtc      1500
     gagcgcgtca ccacgaccga gcacccgacg cgccggttca ccccgatccg gccggtgctc      1560
     ccgccggcgc tggccacccc gaggccaccg gcctcgcccc tgccaccgcc cggcagcgtg      1620
     agcgtgccgg accacctgaa cgcgccgacg aagaaattcg cccccgtcaa gcccccgaag      1680
     cggccgtcgc cgttcaagcg cgatcacgcc gaaccgaacc acaagggcga actgaacgcc      1740
     gacctcgaac ccgaaaagag cactgtgaca accggggcgt cgccccgggc cgggggctcc      1800
     gccacccgga cccccgaaaa gagcactgtg acaaccgggg ctttgccccg ggccgggggc      1860
     tccgccaccc agacccccga aaagagtgct gtgacaaccg gggcttcgcc ccgggccggg      1920
     ggctccgcca cccagacccc cgaaaagagt gcgtga                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page