(data stored in ACNUC30630 zone)

EMBL: CP002000.PE55

CP002000.PE55        Location/Qualifiers
FT   CDS_pept        complement(59930..61165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0057"
FT                   /product="FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41881"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX23"
FT                   /protein_id="ADJ41881.1"
FT                   /translation="MGRAERFDRRLENLVGNTFARMFGGNVVTQEVAIALERESEENVR
FT                   ELAGGRQLAPNHYIVSLGAADHERMAGDEQRVTQVLAKAVAEHLAAAGLDTYGDVVVSL
FT                   ERNEALHTGQFKTRSSVDPDARPSGAGSPRSARPSNAGDPAMSQPPGYGQYDQGDPYGQ
FT                   QGQYGYGQQGGQQPGYDQGYGQQGGYDQYGGQQPQGGGYDQYGQPQQGGGYDQYGQQPQ
FT                   AGYDQGYAQPQGGGYDQGGYQQPQGGGYDQGYGQPQGGGYDQGGYQQGGYDQYGQQQPQ
FT                   GGYDQYGQQQAYGQPAADPYAQQQGGYGQPAPGRQLAASLQLDDGSNRTYSLKQGGNVV
FT                   GRGQDADFRLPDTGVSRRHLEITWDGQSATLADIGSTNGTTVNGTPVQTWQLADGDVIR
FT                   VGHSSLVFRTQG"
     gtgggccgcg ccgaacgatt cgacaggcga ctcgagaacc tggtggggaa cactttcgcg        60
     cgcatgttcg gtggcaacgt cgtcacgcag gaagtggcga tcgccctgga gcgggagagt       120
     gaggaaaacg ttcgtgagct ggcaggcggt cggcagctcg cccccaatca ctacatcgtg       180
     tccctgggag cggctgacca cgagcgcatg gccggtgacg agcaacgcgt cacccaggtg       240
     ctggccaaag cggtggcgga acacctcgcc gccgcgggcc tggacaccta tggtgacgtc       300
     gtcgtatcac tcgagcgcaa cgaggcgctg catactggac agttcaagac ccgttcgtcc       360
     gtcgatcccg acgcccgccc ctcaggcgcc ggttcaccgc ggtcggcacg acccagcaac       420
     gcaggagacc cagcaatgag ccagcccccc ggctacggcc aatacgacca gggtgacccg       480
     tacggccagc agggccagta cggctacgga cagcagggtg gccagcagcc cgggtacgac       540
     cagggttacg gccagcaggg tggatacgac cagtacggcg gccagcagcc gcaaggcggt       600
     ggctacgacc agtacggcca gccgcagcag ggtggtggct acgaccagta cggccagcag       660
     ccccaggccg gctacgacca gggctacgcc cagccccaag gcggaggcta cgaccagggc       720
     ggctaccagc agccgcaagg cggtggctac gaccagggct acggccagcc ccagggcgga       780
     ggctacgacc agggcggcta ccagcagggt ggctacgacc agtacggcca gcagcagccc       840
     cagggcgggt acgaccagta cggccagcag caggcgtacg gccagcctgc cgcggacccg       900
     tacgcccagc agcagggcgg ctacggccag cccgcgccgg gccgtcagct cgcggcgagc       960
     ctgcagctgg acgacggctc gaaccgcacg tactcgctga agcagggcgg gaacgtcgtg      1020
     ggccggggcc aggacgcgga cttccgcctg cccgacaccg gggtttcgcg ccgccacctg      1080
     gagatcacct gggacggcca gagcgcgacg ctcgccgaca tcggctccac gaacggcacg      1140
     accgtgaacg gcaccccggt ccagacctgg cagctcgccg acggcgacgt catccgggtg      1200
     ggtcactcct ccctggtgtt ccgtacacag ggctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page