(data stored in ACNUC30630 zone)

EMBL: CP002000.PE592

CP002000.PE592       Location/Qualifiers
FT   CDS_pept        complement(610894..611754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42418"
FT                   /db_xref="GOA:A0A0H3CVU5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU5"
FT                   /protein_id="ADJ42418.1"
FT                   /translation="MAEQRDDGKPGSDIEPAGPNTPTPGSPPQPPVDPAQLEQFRQFQQ
FT                   FQDYLRFTQAQQGNQPAPTPDAGMVQAPASQPATQQGGQPPAIPPGYQLVPTERRRAPR
FT                   WLSWLGKKVLAWALAIVILGVAGTWLYNHFFPNDSGKTSAQLAQEGGGKYQTNHILSTS
FT                   PYEAVREVYDAIAQNLVPQACGRMDEPIQQKFAQDLGYADCQVAVHELNRKVTNKNQYA
FT                   ESMPSYVSEPIPGDRFTISSCRFGIEGGPALGAFTVAKVPKGQWLIVEHTNEPTPCPLP
FT                   TPTSR"
     gtggcggagc agcgcgatga cggaaagccg ggctcggaca tcgaaccggc gggcccgaac        60
     acgcccaccc cggggtctcc tccccagccg ccggtggacc cggcgcagct cgagcagttc       120
     cgccagttcc agcagttcca ggactacctg cggttcacgc aggctcagca gggcaaccag       180
     ccggcaccca caccggacgc cgggatggtc caggcgcccg cttcccagcc tgccacccag       240
     cagggcgggc agcctccggc cattcccccc ggctaccagc tcgtcccgac cgagcgccgt       300
     cgagcgccgc gatggctgag ctggctgggc aagaaggtgc tcgcgtgggc cctggcgatc       360
     gtgatcctcg gcgtcgcggg cacgtggctg tacaaccact tcttccccaa cgactcgggc       420
     aagacctccg cccagctcgc ccaggagggc ggcgggaagt accagaccaa ccacatcctt       480
     tcgacgagcc cgtacgaagc cgtccgcgag gtctacgacg ccatcgcgca gaacctcgtc       540
     ccgcaggcgt gcgggcggat ggacgagccg atccagcaga agttcgccca ggacctgggt       600
     tacgcggact gccaggtcgc ggtgcacgag ctgaaccgca aggtcaccaa caagaaccag       660
     tacgccgaat cgatgccgtc gtacgtctcg gagccgatcc cgggcgaccg gttcacgatc       720
     agctcgtgcc ggttcggcat cgaaggcggc ccggcgctcg gcgcgttcac cgtggcgaag       780
     gtgccgaagg gccaatggct gatcgtcgag cacaccaacg agcccacgcc ctgcccgctg       840
     ccgacgccga ccagccgcta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page