(data stored in ACNUC30630 zone)

EMBL: CP002000.PE600

CP002000.PE600       Location/Qualifiers
FT   CDS_pept        618607..619593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0606"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42426"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYQ8"
FT                   /protein_id="ADJ42426.1"
FT                   /translation="MKSFQKRNPVPIALVGIVVLALAFTAALNSDDLPVIGGGTTYSAE
FT                   FSEASGLQKDNDVRIAGVKVGKVSDIALDGASVKVSFKVKDAWLGDRTSAAIKIKTLLG
FT                   QKYLSLDPQGETALNPGTGIPRDRTMAPYDVLDAFRGLSQTVDNIDTKQLAQSFDTISQ
FT                   TFANTPQDVKGALSGLSKLSDTIASRDQQLSNLLANTRQVSQTLVDRDAEVQKLLDDGN
FT                   DLLAELAKREDAITALLDGSRELATQLQGLIDDNGKQLDPVLTQLDQLTSMLQRNQDSL
FT                   AEGLKKFAPFIRVFTNTIGNGRWFDNYICGLLLPSFGPINEEGCYTK"
     atgaagtcct tccagaagcg caaccccgtg ccgatcgcgc tggtcgggat cgtcgtgctg        60
     gcgctcgcct tcaccgccgc gctcaactcc gacgacctgc cggtgatcgg cgggggcacc       120
     acctacagcg ccgagttcag cgaggcttcc gggctgcaga aggacaacga cgtccggatc       180
     gccggcgtca aggtcggcaa ggtcagcgac atcgcgctcg acggcgcgtc ggtgaaggtg       240
     tctttcaagg tcaaggacgc ctggctgggc gaccggacca gtgccgcgat caagatcaag       300
     acgttgctcg ggcagaagta cctgtcgctg gacccgcagg gtgagaccgc gctgaacccg       360
     ggcaccggca tcccgcgcga ccgcacgatg gcaccctacg acgtgctcga cgccttccgc       420
     gggctgtccc agaccgtcga caacatcgac accaagcagc tggcgcagag cttcgacacg       480
     atctcgcaga ccttcgccaa cacgccgcag gacgtgaagg gcgcgctgtc ggggctgtcg       540
     aagctgtcgg acacgatcgc ctcgcgcgac cagcagctgt cgaacctgct ggccaacacc       600
     cgccaggtgt cgcagacgct ggtcgaccgc gacgccgagg tgcagaagct gctcgacgac       660
     ggcaacgacc tgctcgccga gctggccaag cgcgaggacg cgatcaccgc gctgctggac       720
     ggctcccgcg agctggccac ccagctgcag ggcctgatcg acgacaacgg aaagcagctc       780
     gacccggtgc tgacccagct cgaccagctg acgtcgatgc tgcagcgcaa ccaggactcc       840
     ctcgccgagg ggctcaagaa gttcgcgccg ttcatccgcg tcttcaccaa caccatcggc       900
     aacggccgct ggttcgacaa ctacatctgc ggcctgctgc tgccgtcgtt cggcccgatc       960
     aacgaagagg ggtgctacac gaaatga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page