(data stored in ACNUC30630 zone)

EMBL: CP002000.PE603

CP002000.PE603       Location/Qualifiers
FT   CDS_pept        621943..623208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0609"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42429"
FT                   /db_xref="GOA:A0A0H3CWX3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWX3"
FT                   /protein_id="ADJ42429.1"
FT                   /translation="MLIRRTKIQLIAFVVISVVAIVYALIRFAGLGSVFGNDGYTVKLQ
FT                   LNESGGIFTNAEVTYRGYNIGRVGEMRLTATGLEADLNIDPSAPKVPADLDAVVANRSA
FT                   VGEQYVDLKPKADQGPYLAAGSVIPATKTTTPVSTDRLIGDLDSLAASVPVDSLRTVVD
FT                   ESYDAFRGTGGDLQKLLDTARSFTTTAQQYLPQTIQLLDAGGQVLDTQNAEAANFASFS
FT                   KSLNELTGTLKNSDGDLRKLIGITPQVASQISQVLAESGPGLGALTANLLTTANLTVTR
FT                   LDGIEQGLVTYPALAGAASSVAPGDGTAHLGLVLNLFNPPACTKGYLPYSKYRTGNDLS
FT                   AKPAKEDAYCAEPKGSPINVRGAQNAPYGGVPVAPSDSDVSANANRPAQELAEERDTRG
FT                   VPGIVGSPGVSLTSLGSLLGLT"
     atgctgatcc gccggacgaa gatccagctg atcgccttcg tggtgatctc ggtcgtcgcg        60
     atcgtgtacg cgctgatccg gttcgccggg ctcggcagcg tgttcggcaa cgacggctac       120
     acggtgaagt tgcagctcaa cgaatcgggc ggcatcttca ccaacgccga ggtgacctac       180
     cgcggctaca acatcggccg tgtcggcgaa atgcggctca ccgcgaccgg gctcgaggcc       240
     gacctcaaca tcgacccctc ggcgccgaag gtacccgcgg acctcgatgc cgtcgtcgcc       300
     aaccggtcgg cggtcggcga gcagtacgtc gacctcaagc cgaaggccga ccagggcccc       360
     tacctggcgg ccggctcggt gatcccggcg accaagacga ccacgccggt cagcaccgac       420
     cggctgatcg gcgacctcga ctcgctcgcc gcgtcggtcc cggtcgactc gctgcgcacg       480
     gtcgtcgacg agtcctacga cgccttccgc ggcaccggcg gcgacctgca gaagctgctg       540
     gacaccgcgc gcagcttcac cacgacggcg cagcagtacc tgccgcagac gatccagctg       600
     ctggacgccg gcggccaggt gctggacacg cagaacgccg aggcggcgaa cttcgcctcg       660
     ttcagcaaga gcctcaacga gctcaccggc acgctgaaga actccgacgg cgacctgcgc       720
     aagctcatcg ggatcacccc gcaggtggcg tcgcagatca gccaggtgct ggccgaatcc       780
     ggcccgggcc tgggtgcgct gacggcgaac ctgctcacca cggccaacct gaccgtgacc       840
     cgcctcgacg ggatcgagca gggcctggtc acctacccgg cgctggccgg cgcggcgagc       900
     agcgtggcgc ccggcgacgg caccgcgcac ctcggcctgg tgctcaacct gttcaacccg       960
     ccggcctgca cgaaggggta cctgccgtac tcgaagtacc gcaccggcaa cgacctctcg      1020
     gcgaagccgg cgaaggaaga cgcgtactgt gccgaaccga agggcagccc gatcaacgtc      1080
     cgcggggcgc agaacgcgcc ctacggcggg gtgccggtcg cgccgtcgga cagcgacgtc      1140
     tcggccaacg cgaaccggcc ggcgcaggag ctggccgagg agcgggacac ccggggggtg      1200
     ccgggcatcg tcggcagccc cggcgtcagc ctgaccagcc tgggctcgct gctcggcctg      1260
     acctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page