(data stored in ACNUC30630 zone)

EMBL: CP002000.PE609

CP002000.PE609       Location/Qualifiers
FT   CDS_pept        628150..628377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42435"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK8"
FT                   /protein_id="ADJ42435.1"
FT                   /translation="MEAAMSVTQVKIALSGGPAELAPAHRSVDSGALENTLKIRHGAGY
FT                   EHFVHGGEFQAVDGCDIAVFRWSHRTKIAE"
     gtggaggccg cgatgagtgt tacgcaggtg aaaatcgcgt tgagcggtgg accggccgaa        60
     ctggcgccgg cgcaccgcag cgtcgactcc ggcgcgctgg agaacacgct caagatccgc       120
     cacggggccg gttacgagca tttcgtgcac ggcggcgaat tccaggccgt cgacggctgc       180
     gacatcgcgg tcttccggtg gtcgcaccgc acgaagatcg ccgaataa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page