(data stored in ACNUC30630 zone)

EMBL: CP002000.PE646

CP002000.PE646       Location/Qualifiers
FT   CDS_pept        711954..712865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0652"
FT                   /product="transketolase C-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42472"
FT                   /db_xref="GOA:A0A0H3CV00"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV00"
FT                   /protein_id="ADJ42472.1"
FT                   /translation="MTAQVTRKQMRTVFAETVIESLATDPRVVMLTADISSWFFWEVKK
FT                   DFPDRVHNFGIREQAMIDIAGGFALAGQRPVVHTYAPFLVERPFEQIKIGLGHQDVGAV
FT                   LVSVGASYDDPSWGRTHQAPGDVALLDTLPGWTVHVPGHEDEVAPLLSKAIAGDNRVYV
FT                   RLSERANSEAVPVSEKFTVLRRGKAGVVLAVGPVLDQVLAATATADVTVLYASTIRPFD
FT                   HAGLREAVAAAAPNVVLVEPYLRGTSAFEVTEALGDVPHRLRSFGTWRDREARVYGTPE
FT                   EHDRLFGVDAESLADSIARFVG"
     atgaccgccc aggtgaccag gaagcagatg cggaccgtct tcgccgagac ggtgatcgag        60
     tcgctggcca cggacccgcg cgtggtcatg ctgaccgccg acatctcgtc gtggttcttc       120
     tgggaggtca agaaggactt cccggaccgc gtccacaact tcggcatccg cgagcaggcg       180
     atgatcgaca tcgccggcgg cttcgcgctg gccggccagc ggccggtggt gcacacgtac       240
     gcgccgttcc tggtcgagcg gccgttcgag cagatcaaga tcggcctcgg ccaccaggac       300
     gtcggcgcgg tgctggtcag cgtgggcgcc tcctacgacg acccgtcgtg gggccgcacc       360
     caccaggccc cgggcgacgt ggcgctgctg gacacgctgc cgggctggac ggtgcacgtc       420
     ccgggccacg aggacgaggt cgcgcccctg ctgagcaagg ccatcgcggg tgacaaccgg       480
     gtctacgtcc ggctgtccga acgcgcgaac agcgaagcgg tgccggtgtc ggagaagttc       540
     acggtgctgc gccggggcaa ggcgggcgtg gtgctcgcgg tcggcccggt gctggaccag       600
     gtcctggcgg ccacggccac ggcggacgtg acggtgctgt acgcctcgac gatccgcccg       660
     ttcgaccacg cgggcctccg ggaggcggtg gccgcggcgg ccccgaacgt ggtgctggtc       720
     gagccgtacc tgcgcgggac gtcggcgttc gaggtgaccg aggctctggg agacgtcccg       780
     caccgcctgc gctcgttcgg aacctggcgc gaccgcgaag cccgcgtcta cggaacgccc       840
     gaggaacacg accgcctgtt cggcgtggac gccgagtcgc tggcggattc gatcgcccgc       900
     ttcgtcggct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page