(data stored in ACNUC30630 zone)

EMBL: CP002000.PE65

CP002000.PE65        Location/Qualifiers
FT   CDS_pept        71616..73085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0067"
FT                   /product="periplasmic substrate-binding component of
FT                   ABC-type dipeptide/oligopeptide transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41891"
FT                   /db_xref="GOA:A0A0H3CX33"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX33"
FT                   /protein_id="ADJ41891.1"
FT                   /translation="MAAVLLLAVSGCSAGSSASVSAGPNTLSVGFTAEPANFDFTRTDG
FT                   AAIPQALLYNVYEGLVRLDAQGRVVPLLAKSWTISPDRKTYDFQLQQGVKFSNGAPFTA
FT                   EDVKFSLLRVKTDWTISIKANMDVIDHVDVEAPDHARVVLSKPSNGWLFSLTSRLGAMF
FT                   SPTGIADLANKPVGTGPYVVAARKRGDSVVLKANPAYWGRKPAYGTVVLKYIKDPTALN
FT                   NALFSNGIDVISAITAPDSIPQFQADDRFQVVQGTSNSEVTLAMNNARPPLNDVRVRQA
FT                   LTYAIDRKALLDTAWAGRGTLIGSMVPPTDPWYEDLANVHPFDPAKAKALLTEAHATNL
FT                   NLRLRIPNLPYAVSAAQVVQSQLADVGVRTTIEPLDFPAVWLKQVFTDHDYDLSIIQHV
FT                   EARDITTFGKPKYYWGYDSKRVQQLLAEADSGTPEQQVADMKQVARQLNTDAAADWLFL
FT                   FPNVIVAKAKVGGFVQNQVSESFDLTGLAPR"
     gtggcagcgg tgctgctgct ggcggtgtcc ggctgctcgg ccggctcgtc ggcgagcgtt        60
     tccgcaggtc cgaacacgct ttccgtcggc ttcacggcgg agccggcgaa cttcgacttc       120
     acccgcaccg acggcgccgc cattccgcag gcgctgctct acaacgtcta cgaaggcctg       180
     gtgcggctcg acgcgcaagg ccgtgtggtg ccgctgctcg cgaagtcgtg gaccatcagc       240
     ccggaccgga agacctacga cttccagctc cagcagggcg tcaagttcag caacggcgcc       300
     cccttcaccg ccgaggacgt caagttctcg ctcctgcggg tgaagaccga ctggacgatc       360
     tcgatcaagg cgaacatgga cgtcatcgac cacgtcgacg tcgaggcgcc ggaccacgcg       420
     cgggttgtcc tctcgaagcc gtccaacggc tggctgttca gcctcaccag ccggctcggc       480
     gcgatgttca gccccaccgg aatcgccgac ctggcgaaca agccggtcgg taccgggccg       540
     tacgtcgtgg cggcgcgcaa gcgcggcgac tccgtggtgc tgaaggcgaa tccggcctac       600
     tggggccgga aaccggcgta cggcacggtc gtcctcaagt acatcaagga cccgaccgcg       660
     ctgaacaacg cgttgttcag caacggcatc gacgtcatct ccgcgatcac cgcgcccgac       720
     tcgatcccgc agttccaggc cgacgaccgg ttccaggtcg tccagggcac ctcgaactcc       780
     gaagtcacgc tggcgatgaa caacgcccgg ccgcccctga acgacgtccg cgtgcgccag       840
     gcgctgacgt acgcgatcga ccggaaggcg ctgctcgaca cggcgtgggc gggccgcggc       900
     acgttgatcg gcagtatggt cccgccgacc gacccctggt acgaggacct ggcgaacgtc       960
     catccgttcg atcccgcgaa ggcgaaagcg ctgctgacgg aagcgcatgc gacgaacctg      1020
     aacctgcggt tgcgaatccc gaacctgccg tacgcggtgt cggcggcgca ggtcgtccag      1080
     tcgcagctcg ccgacgtcgg cgtgcggacc acgatcgagc cgctcgactt cccggcggtg      1140
     tggctcaagc aagtgttcac cgaccacgac tacgacctgt cgatcatcca gcacgtcgag      1200
     gcgcgggaca tcacgacgtt cgggaagccg aagtactact ggggttacga cagcaagcgc      1260
     gtccagcagc tgctcgccga ggccgacagc ggcacgccgg agcagcaggt cgcggacatg      1320
     aagcaggtgg cgcggcagct gaacaccgac gcggccgcgg actggctgtt cctgttcccc      1380
     aacgtcatcg tggcgaaggc caaggtcggc gggttcgtcc agaaccaggt cagcgagtcc      1440
     ttcgacctca ccgggctggc gccgcgatga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page