(data stored in ACNUC30630 zone)

EMBL: CP002000.PE658

CP002000.PE658       Location/Qualifiers
FT   CDS_pept        731864..732571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42484"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX26"
FT                   /protein_id="ADJ42484.1"
FT                   /translation="MDVQGYGGRDDRQHASIQSGLLAVADTAAGRCGLDRTTWHRQGAG
FT                   DGELAILPPGTPEPAVVDDYVRELVTALADHNHDLAAENRMRIRIAIHHGVAMPGANGW
FT                   TGQGVVGVSRLVDSAPVRGALRAFPAADLAVLVSRQIYTDVVAQRHTSLKPGEFREVVV
FT                   RQKEFTDVAWLRVPGHDVHGAQLSADPPRVPADSAGTRVTGAAGHSYRADAITVVNGSV
FT                   DAPNAVFGIKHGS"
     atggacgtgc aaggctacgg cggccgggac gaccggcagc acgcttcgat ccaatccggc        60
     ctgctcgccg tggcggacac cgccgccggc cggtgcggcc tggaccggac gacctggcac       120
     cggcagggcg ccggcgacgg cgaactggcg atcctcccgc cgggcacccc cgaaccggcg       180
     gtcgtggacg actacgtccg tgagctggtc acggcgctcg ccgaccacaa ccacgacctc       240
     gcggcggaga accggatgcg catccggatc gccatccacc acggcgtcgc gatgcccggc       300
     gcgaacggct ggacgggaca gggcgtggtg ggcgtgagcc gcctcgtcga cagcgccccc       360
     gtccgcggcg ccctccgcgc gttcccggcc gccgacctgg ccgtgctcgt gtcgcggcag       420
     atctacaccg acgtcgtggc ccagcgccac acctcgctga agccggggga gttccgggaa       480
     gtcgtggtgc ggcagaagga attcaccgac gtggcctggc tccgggtgcc ggggcacgac       540
     gtgcacggcg cgcagctctc ggccgatccg ccccgcgtcc cggctgattc ggcaggcacc       600
     cgggtgaccg gcgcggccgg gcacagctac cgcgccgacg cgatcaccgt ggtcaacggg       660
     agcgtcgacg cgccgaacgc ggtcttcggg atcaagcacg gctcatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page