(data stored in ACNUC30630 zone)

EMBL: CP002000.PE662

CP002000.PE662       Location/Qualifiers
FT   CDS_pept        737374..737598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42488"
FT                   /db_xref="GOA:A0A0H3CW10"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW10"
FT                   /protein_id="ADJ42488.1"
FT                   /translation="MTPVTKRLTVVAVVLITAGAVLLAVGAIGFRATSDQPDANIGAGF
FT                   ALLAGPYVVGLGLVFALSAGLTHLTTRRR"
     atgacgcccg tcaccaaacg cctcacggtg gtcgccgtcg tgctgatcac ggccggcgcg        60
     gtcctgctcg cggtgggagc gatcggcttc cgggcgacgt cggatcagcc cgacgccaac       120
     atcggcgcgg ggttcgccct gctggccggg ccctacgtcg tcggcctcgg gctggtgttc       180
     gccctgtcgg cgggcctgac ccacctcacg acgcgccgcc gctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page