(data stored in ACNUC30630 zone)

EMBL: CP002000.PE99

CP002000.PE99        Location/Qualifiers
FT   CDS_pept        105186..106835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41925"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV68"
FT                   /protein_id="ADJ41925.1"
FT                   /translation="MISMNTEVVLDAGAVSRCRRRVHLEHDPAMREVPLSPPDPTAQQR
FT                   IDDATAHRENIVARLMAANDDHWVKVGRDLPAHERVEQTLQAFADGARFIWGALLPVDA
FT                   AGHRRGGIDLLVRTGRGYVPVLVVRHRITDRGAGAIVTGMTDLDPAHRAADEGRKVRSQ
FT                   PRDQLRLVHIRRMLQTLGQADESLALGGVIGLDADVVVWHDLTAGTWPGGRTALTEYQA
FT                   RFADRLAIATAAANGEEPLAEPSRVLECRRCPWWPTCEVVLTDTRDVSLVVRGEDAVEL
FT                   RRAGVSTVDQLAALDPAGEPPAVNWTGVTFPDAVVLARAWLADLTLVRRVGRVEVPRAD
FT                   VEVDVDMESFGDAGAYLWGCLLSGADIGVEQGYRAFATWDPLPTDDEARSFAEFWAWLA
FT                   DVRERTEAAGLTFRAYCYNALAENRWLFGSVERFGEHPGVPAKKDIQSFVDSEQWVDLF
FT                   RSVTDQFLCSHGKGLKVIAPVAGFSWRDPEAGGEASMRWYRDAVGMDGEKPDDDQRARL
FT                   LRYNEDDVLATRALREWIDARAQAEVPYMFDL"
     gtgatctcca tgaacaccga ggtggtactc gacgcgggcg cggtcagccg ctgccgtcgc        60
     cgcgtgcacc tcgaacacga ccccgccatg cgcgaggtac cgctttcccc gcccgatccc       120
     accgcgcagc agcggatcga cgacgccacc gcccatcgcg agaacatcgt cgcacggttg       180
     atggccgcca acgacgacca ctgggtgaag gtcggccgcg atctgcccgc ccacgagcgc       240
     gtcgagcaga cgctgcaggc cttcgccgac ggggcgcggt tcatctgggg tgcgctgctg       300
     ccggtcgacg cggccgggca ccggcgtggc ggcatcgacc tgctcgtccg caccggccgc       360
     ggctacgtcc cggtgctcgt cgtgcgccac cgcatcaccg accgcggtgc cggcgcgatc       420
     gtcaccggga tgaccgacct cgacccggcg caccgcgcgg ccgacgaggg ccgcaaggtc       480
     cggtcgcagc cgcgtgacca gctccggctc gtgcacatcc gccgcatgct gcagacgctc       540
     gggcaggccg acgagagcct cgcgctcggc ggcgtcatcg gcctcgacgc cgacgtcgtc       600
     gtctggcacg acctcacggc aggcacctgg ccgggcgggc gcaccgcgct caccgagtac       660
     caagcccggt tcgccgaccg gctcgccatc gccaccgccg ccgcgaacgg cgaagagccc       720
     ctcgcggagc cgtcgcgcgt gctggagtgc cggcgctgcc cgtggtggcc gacgtgcgag       780
     gtcgtgctca ccgacacccg cgacgtcagc ctcgtcgtcc gcggcgagga cgccgtcgag       840
     ctgcgccgcg ccggtgtgtc cactgtggac cagctggccg cgctggaccc ggcgggcgag       900
     ccgccggcgg tgaactggac cggcgtcacg ttcccggacg ccgtcgtgct cgcccgggcg       960
     tggctggccg acctgacgct ggtgcgccgc gtcggccggg tcgaggtgcc gcgcgccgac      1020
     gtcgaggtcg acgtcgacat ggagagcttc ggcgacgccg gcgcgtacct ctggggctgc      1080
     ctgctcagcg gcgccgacat cggcgtcgag cagggctacc gcgccttcgc gacgtgggac      1140
     ccgctgccca ccgacgacga agcgcgctcc ttcgccgagt tctgggcctg gctcgccgac      1200
     gtccgagagc gcaccgaagc ggcgggtctg accttccgcg cctactgcta caacgcgctc      1260
     gccgagaacc gctggctctt cggctccgtc gagcgcttcg gcgagcaccc cggtgtcccg      1320
     gcgaagaagg acatccagtc ctttgtggat tccgagcagt gggtggacct gttccgcagc      1380
     gtcaccgacc agttcctgtg ctcccacggc aagggcctga aggtgatcgc cccggtggcc      1440
     ggcttctcct ggcgcgaccc ggaggcgggc ggcgaggcgt cgatgcgctg gtaccgcgac      1500
     gccgtgggca tggacggcga gaagccggac gacgaccagc gcgcgcggct gctgcgctac      1560
     aacgaggacg acgtcctcgc gacgcgcgcg ctgcgcgagt ggatcgacgc gcgggcgcag      1620
     gccgaagtcc cgtacatgtt cgatctctga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page