(data stored in ACNUC30630 zone)

EMBL: CP002000.RESB

CP002000.RESB        Location/Qualifiers
FT   CDS_pept        500172..501767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resB"
FT                   /locus_tag="AMED_0498"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42319"
FT                   /db_xref="GOA:A0A0H3CWM1"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWM1"
FT                   /protein_id="ADJ42319.1"
FT                   /translation="MTTTEAPPKTPQGPTPAKRTFAFARNTWRGLTSMRTALVLLFLLA
FT                   LAALPGALLPQRKLNAPKVAEYITAHGWWGTLLDKLEFYDVYSSIWFSAIYLLLMISLI
FT                   GCLTPRSFEYVRAMRAKPVLTPRNLARMPHYRLGRGKTDVAAEIAAVHKQLSGWRRIER
FT                   EEADGVRTISAERGFLRETGNLVFHFSMLGLIVFFAIGKLYGYEGQVIVQADGDSFCNA
FT                   GIYNYDSFNAGLRVDGTDLDPFCVKVHDFTARYTASGQPDYYHSNIEYQSGPDLETGIW
FT                   RPYGLEVNSPLRTAGDRVYLLGHGYSPKFTVTFPDGSQRTQNTQWRTVDPSTMLAEGAT
FT                   KFDQPGITDEVQRRTRQLAITGLFAPTAFLHGSVLTSSAPEADDPAVAVDVLRGDLGLD
FT                   AGRGQSVFEVDQTLVDDGRLKKVARQNLKVGQELKLDDGTKVRFDGVGQWVSLQVSHDP
FT                   TQGFVLGFAIAMFLGLGGSLLVKRRRLWVRVKPGTEDDPGTVIEVAGLARTDQAGYGEE
FT                   FHRVSERLISGQKG"
     gtgacgacca ccgaggcacc cccgaagacc ccgcaaggcc ccacgcccgc caagcgcacc        60
     ttcgccttcg cgcgcaacac ctggcgcggc ctgacgtcga tgcgcaccgc gctcgtcctg       120
     ctgttcctcc tcgccctggc cgcgctgccg ggcgcgctgc tgccgcagcg gaagctcaac       180
     gcccccaagg tcgccgaata catcaccgcc cacggctggt gggggacgct gctcgacaag       240
     ctcgagttct acgacgtcta ctccagcatc tggttctcgg ccatctacct gctgctgatg       300
     atctcgctga tcggctgcct gaccccgcgc agcttcgagt acgtccgggc gatgcgcgcc       360
     aagccggtgc tgacgccgcg caacctcgcg cggatgccgc actaccggct cgggcggggc       420
     aaaaccgacg tcgccgccga gatcgcggcc gtccacaagc agctttccgg ctggcgccgc       480
     atcgagcgtg aggaagccga cggcgtccgc acgatctcgg ccgaacgcgg gttcctgcgc       540
     gagaccggca acctcgtctt ccacttcagc atgctcggcc tgatcgtctt cttcgccatc       600
     ggcaagctct acggctacga aggccaggtc atcgtccagg ccgacggcga cagcttctgc       660
     aacgccggca tctacaacta cgactccttc aacgccggcc tgcgcgtcga cggcaccgac       720
     ctcgacccgt tctgcgtgaa ggtccacgac ttcaccgcgc gctacaccgc ctccggccag       780
     cccgactact accactcgaa catcgagtac cagtccggcc cggacctcga gacgggcatc       840
     tggcgcccgt acggcctcga ggtcaactcg ccgctgcgca ccgccggcga ccgcgtctac       900
     ctgctcgggc acggctactc gccgaagttc acggtcacct tcccggacgg ctcgcagcgc       960
     acccagaaca cccagtggcg cacggtcgac ccgagcacca tgctcgccga gggcgcgacg      1020
     aagttcgacc agcccggcat caccgacgag gtgcagcggc ggacccgcca gctggccatc      1080
     accggcctgt tcgcgcccac ggcgttcctg cacggcagcg tcctgacgtc gtcggcgccc      1140
     gaggcggacg accccgccgt cgccgtcgac gtcctgcgcg gcgacctggg cctcgacgcc      1200
     gggcgcggcc agtccgtgtt cgaggtcgac cagaccctcg tcgacgacgg caggctgaag      1260
     aaggtcgccc gccagaacct gaaggtcggc caggagctca agctcgacga cggcacgaag      1320
     gtccgcttcg acggcgtcgg ccagtgggtc tccctgcagg tttcccacga ccccacgcag      1380
     gggttcgtgc tcggcttcgc catcgcgatg ttcctcggcc tcggcgggtc cttgctggtc      1440
     aagcgccgcc ggctgtgggt gcgggtgaag ccgggaaccg aggacgaccc gggtaccgtg      1500
     atcgaggtcg ccgggctggc ccgcaccgac caggccgggt acggcgaaga gttccaccgg      1560
     gtcagtgaac gcttgatcag tgggcagaag ggctga                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page