(data stored in ACNUC30630 zone)

EMBL: CP002000.RPSJ

CP002000.RPSJ        Location/Qualifiers
FT   CDS_pept        744602..744907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="AMED_0676"
FT                   /product="small subunit ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42496"
FT                   /db_xref="GOA:A0A0H3CYX7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYX7"
FT                   /protein_id="ADJ42496.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDTSARKIVETVTRTGARVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ"
     atggcgggac agaagatccg catccggctc aaggcctacg accacgaggc gatcgacacc        60
     tcggcgcgca agatcgtgga gacggtcacg cgcaccggcg cccgtgttgt cgggccggtg       120
     ccgctgccca ccgagaagaa cgtttactgc gtcatccgct cgccgcacaa gtacaaggac       180
     tcgcgcgagc acttcgagat gcgcacgcac aagcgtctga tcgacatcct cgacccgacg       240
     ccgaagacgg tcgacgcgct catgcgcatc gacctgccgg cgagcgtcga cgtcaacatc       300
     cagtag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page