(data stored in ACNUC30630 zone)

EMBL: CP002000.SRTA

CP002000.SRTA        Location/Qualifiers
FT   CDS_pept        41881..42939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtA"
FT                   /locus_tag="AMED_0039"
FT                   /product="sortase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41863"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUB8"
FT                   /protein_id="ADJ41863.1"
FT                   /translation="MPPREPMPPRRPPSPGRSATPPRGQVPPRRPQRGPQDQPPPRPQG
FT                   RPPRRYTGPTPPPGANEETVIFAPVGKGGTATEEKSAPAPLGKGGVAIRTAGEILITLG
FT                   LVVLLFMVYELYVTDLFSAGKQSEASDQLDGEWAHDRTLHPELVDGKAFARIHIPSFGV
FT                   DYNFTIQEGTDDAALEVGPGHYKGTALPGEPGNFAVAGHRVGKGAPFNDLDNLSSCDQI
FT                   VIETSADFYIYKVLPYDDEMKDWAAGKGADPKCKGVSTLRDQNAEDGGAYSETFGRKVV
FT                   LPSQGTAVNPVPYKGAEALPKAQQAALLTLTTCHPQFSAKERLIITSVLTQQVPKNQVK
FT                   DYGDLLSKIGEA"
     atgccgccgc gcgagcccat gccgccgcgc cggccaccgt caccgggccg ttccgccacg        60
     cccccgcgcg gccaggtgcc gccccgccgg ccccagcgcg gcccccagga ccagccaccc       120
     ccgcgtccgc agggccggcc gccccgccgc tacaccggcc cgaccccgcc gcccggcgcg       180
     aacgaggaga ccgtcatctt cgccccggtc gggaagggcg gcacggcgac cgaggagaag       240
     tcagccccgg ccccgctcgg caagggcggc gtcgcgatcc ggacggccgg cgaaatcctc       300
     atcacgctgg gcctggtcgt gctgctgttc atggtctacg agctctacgt gaccgacctg       360
     ttctcggcgg gcaagcagtc cgaggcgagt gatcagctcg acggcgagtg ggcgcacgac       420
     cgcacgctgc atcccgagct ggtcgacggc aaggcgttcg cccgcatcca catccccagc       480
     ttcggcgtcg actacaactt caccatccag gagggcacgg acgacgcggc cctcgaagtc       540
     ggccccgggc actacaaggg cacggcgctg cccggtgagc ccggcaactt cgcggtggcc       600
     ggccaccgcg tcggcaaggg tgccccgttc aacgacctgg acaacctctc ctcttgtgac       660
     cagatcgtga tcgagacctc cgccgacttc tacatctaca aggttctgcc ctacgacgac       720
     gagatgaagg actgggccgc cggcaagggc gccgatccga agtgcaaggg cgtctccacg       780
     ctgcgtgatc agaacgccga ggacggcggc gcctacagcg agaccttcgg ccgcaaggtc       840
     gtgctgccca gccagggcac cgcggtcaac ccggtcccgt acaagggtgc cgaagcgctg       900
     ccgaaggccc agcaggccgc gctgctcacg ctcaccacct gccacccgca gttctccgcc       960
     aaggagcggc tcatcatcac ctcggtgctc acccagcagg tgccgaagaa ccaggtcaag      1020
     gactacggcg acctgctctc gaagatcggg gaggcctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page