(data stored in ACNUC30630 zone)

EMBL: CP002010.GYRB

CP002010.GYRB        Location/Qualifiers
FT   CDS_pept        5447..7576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BLJ_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99504"
FT                   /db_xref="GOA:D6ZX58"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX58"
FT                   /protein_id="ADG99504.1"
FT                   /translation="MTEVDPVVTEGSLLADETSKEEQLKAAAERINNAELTEGELDESM
FT                   APEHYEASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYASHIE
FT                   VTILPDNGIRVVDDGRGIPVDEVPGEGVSGVETVMTKLHAGGKFGGGGYAVSGGLHGVG
FT                   ISVVNALSTRVDIEVRRQGFHWTQTYIDQHPTAPLKQGDPMTEGESTGTSVTFWADPKI
FT                   FETTIYDFETLRSRFQQMAFLNKGLKISLTDERENDQAGDEVAGDAADEPGAKHQTVTY
FT                   QYLNGIKDYVDYLVKVRKATPVEEDVISFEAEDLKLGISAELAMQWTTAYSEAVHTFAN
FT                   TISTTEGGTHEEGFRAALTSLVNRYARDKGILKDKDENLSGDDVREGLTAVISVKLTNP
FT                   QFEGQTKTKLGNSEAKTFVQRVMTDKLGDWFDAHPNEAKNIIQKAIEASRARLAAKKAR
FT                   ENTRRKSIFESAGMPDKLKDCQSSNPEECELFIVEGDSAGGSAIQGRNPITQAILPLRG
FT                   KILNTERASLDRMMKSDTIESLITAVGGGYGEDFDISKVRYHKVIIMADADVDGAHIAT
FT                   LNLTLFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKANGRQL
FT                   PKGEGIQRYKGLGEMSYQELWETTMDPEHRILKQVHIEDAAAADETFSMLMGDEVEPRR
FT                   LFIQRNAKNVRWIDA"
     atgacggagg ttgaccctgt agtcacggaa ggaagcctgt tggcagacga aaccagcaaa        60
     gaggagcagc tgaaggcggc tgcggaacgc atcaacaatg cggaattgac cgaaggcgaa       120
     cttgacgaat ccatggcccc cgagcattat gaggcctccg atctgagggt gctcgaagga       180
     ctcgaggccg tgcgtatccg ccccggtatg tacatcggtt ccaccggccc gcgcggtttg       240
     caccacctgg tctatgagat cgtcgataac tcggtcgacg aggcgctggc cggatacgcc       300
     agccatatcg aggtcaccat tctgccggac aacggcatcc gcgtggtgga cgatggtcga       360
     ggcatcccgg tcgatgaggt gcccggcgag ggcgtctccg gtgtggagac cgtgatgacc       420
     aagctgcacg ccggcggcaa gttcggcggc ggcggttatg cagtgtccgg cggtctgcac       480
     ggcgtgggta tctccgtggt caacgcactc tccacccgcg tggacatcga agtgcgccgt       540
     cagggcttcc actggaccca gacgtacatc gaccagcacc ccaccgcgcc cttgaagcag       600
     ggcgacccga tgaccgaagg cgagtccacc ggtacgtccg tgactttctg ggccgacccg       660
     aagatcttcg agaccaccat ctacgacttc gagacgctgc gttcccgttt ccagcagatg       720
     gccttcctga acaagggcct caagatcagc ctgaccgacg agcgtgagaa tgaccaggcc       780
     ggcgacgagg tggccggcga cgccgcggac gagcccggcg caaagcacca gaccgtcacc       840
     taccagtacc tcaacggcat caaggactat gtcgactacc tggtcaaggt gcgcaaggcc       900
     acgccggtgg aagaggacgt catcagcttc gaggccgaag acctgaagct cggcatctcc       960
     gccgaactcg ccatgcagtg gaccaccgcc tactccgagg ccgtgcacac cttcgcgaac      1020
     acgatttcca ccaccgaggg cggcactcac gaggagggct tccgcgccgc gctgacctcg      1080
     ctggtcaacc gttacgcgcg tgacaagggc atcctcaagg acaaggacga gaacctctcc      1140
     ggcgacgacg tgcgtgaagg cctgaccgcc gtgatctccg tcaagctcac caacccgcag      1200
     ttcgaaggcc agaccaagac caagctcggc aactccgaag ccaagacctt cgtgcagcgc      1260
     gtgatgaccg acaagctcgg cgactggttc gatgcccacc cgaacgaggc caagaacatc      1320
     atccagaagg ccatcgaggc atcccgcgcc cgtctggccg ccaagaaagc ccgcgagaac      1380
     acccgccgca agtccatctt cgagtccgcc ggcatgcccg acaagctcaa ggactgccag      1440
     tcctccaacc cggaagagtg cgagctgttc atcgtggagg gcgattccgc aggcggctcc      1500
     gccatccagg gtcgtaaccc gatcacgcag gccatcctgc cgctgcgagg caagatcctc      1560
     aacaccgagc gtgccagcct ggaccgcatg atgaagtccg acaccatcga atcgctgatc      1620
     accgcggtcg gcggcggcta cggcgaggac ttcgacatct ccaaggtccg ctaccacaag      1680
     gtcatcatca tggccgacgc cgatgtggac ggcgcgcata tcgccaccct gaacctgacg      1740
     ctgttcttcc gctacatgcg cccgatgatc accgccggct acgtgtacgt ggccatgccg      1800
     ccgctgtacc gcctgaagtg gaccaagggc ccgcacgact tcgtgtacac cgacgccgag      1860
     cgcgaccgtg tgctcgccga aggcaaggcc aatggacgcc agctgcccaa gggcgaaggc      1920
     atccagcgct acaagggtct gggcgagatg agctaccagg agctatggga gaccaccatg      1980
     gaccccgagc accgcattct gaagcaggtg cacatcgagg acgccgccgc ggccgacgag      2040
     accttctcga tgctgatggg cgatgaggtc gaaccccgcc gcctcttcat ccagcgcaac      2100
     gccaagaacg tgcgttggat cgatgcgtaa                                       2130
//

If you have problems or comments...

PBIL Back to PBIL home page