(data stored in ACNUC30630 zone)

EMBL: CP002010.ILVH

CP002010.ILVH        Location/Qualifiers
FT   CDS_pept        complement(452591..453145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="BLJ_0373"
FT                   /product="acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99855"
FT                   /db_xref="GOA:D6ZY59"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY59"
FT                   /protein_id="ADG99855.1"
FT                   /translation="MANYPASQPGSQRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRVTVTADVEAVPLEQIIKQLNKLLHVLKIVELDPNSTVERELVLIKVAA
FT                   DESNRSDVLEIVRLFRVRVVDVNPESLTIEATGAEGKIDALLGLLEHYGVIELVRSGAV
FT                   AVTRGPRALSEKVVGSEVTGR"
     atggctaact atcctgcatc ccagcctggt tcccagcgtc atacgctgtc cgtgctggtg        60
     gagaaccgcc caggcgtgct ggcgcgtatc gccggcctgt tcgcccgtcg tgcgttcaac       120
     atcaactcac tgtccgtctc ccccaccgag cgtccggaca tctcacgcgt cacggtgacc       180
     gccgacgtgg aggccgtgcc actggagcag atcatcaagc agctcaacaa gctgctgcat       240
     gtgctcaaaa tcgtggaact cgacccgaac tccaccgtgg aacgcgaact ggtgctcatc       300
     aaggtggccg ccgacgaatc caaccgttcc gacgtgctgg agatcgtgcg cctcttccgc       360
     gtgcgtgtgg tggacgtgaa tccggaatcg ctgaccattg aggccaccgg tgccgaaggc       420
     aagatcgatg cgctgctggg gcttttggag cattacggtg tgattgagct ggtgcgctcc       480
     ggtgccgtag ccgtgacccg cggcccgcgc gccctgagcg aaaaggtcgt cggttccgag       540
     gttaccgggc gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page