(data stored in ACNUC30630 zone)

EMBL: CP002010.PE111

CP002010.PE111       Location/Qualifiers
FT   CDS_pept        155185..155949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0117"
FT                   /product="putative ABC transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99610"
FT                   /db_xref="GOA:D6ZXG4"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG4"
FT                   /protein_id="ADG99610.1"
FT                   /translation="MNEVEMEKTRRGEQRRRKGLSVFRLKVIGAIFMALNVASVAILPA
FT                   LVDDPSQDMTALTAIVLCAAASWIAVPIYSWLLFDGYRHTHNVWAYGLRLLVVAVVSEV
FT                   PYDLIMAGKPFSLSVQNPVFGLLIALVVLALVDWLAKKYYGAFRWTLTVLVIIAGLLWD
FT                   LLLHVGVDQRVLYTGVLTLSFVMVFYFLNARENSMMFTAGLLGAVMCITPAIGVAFLHY
FT                   RNGEQGFKQPWTKWAFYVIYPVLLVFGALVAA"
     atgaacgaag tcgaaatgga gaagacgcgg cgcggcgagc agcgccgtcg caagggactg        60
     tccgtgttcc gtctcaaggt gatcggcgcg atcttcatgg cgctcaacgt ggcgagcgtc       120
     gcgatactgc ctgcgctggt ggacgacccg agccaagaca tgacagcgct gaccgcgatt       180
     gtactgtgcg cggcggcttc ctggatcgcc gtgccgatct attcgtggct gttgttcgac       240
     ggctaccgtc atacgcataa cgtatgggcg tacgggctgc gactgctcgt cgtggccgtg       300
     gtcagcgagg tgccatacga cctgatcatg gccggcaagc ccttcagcct gagtgtgcag       360
     aacccggtgt tcggactgct catcgccctg gtcgtgctgg cgctggtgga ctggctggcc       420
     aagaaatact acggcgcctt ccgctggacg ctgactgtgc tggtcattat cgcgggcctg       480
     ctgtgggatt tgctgctgca tgtgggcgtg gatcagcgcg tgctgtacac gggcgtgctc       540
     acgctgtcgt tcgtgatggt gttctacttc ctcaacgcac gcgagaattc gatgatgttc       600
     accgccgggc tgctgggcgc ggtgatgtgc atcacgcccg ccatcggcgt ggccttcctg       660
     cactaccgca acggcgagca gggtttcaag caaccatgga ccaagtgggc gttctatgtg       720
     atctacccgg tactgctggt gtttggcgcg ttggtggcgg cgtag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page