(data stored in ACNUC30630 zone)

EMBL: CP002010.PE131

CP002010.PE131       Location/Qualifiers
FT   CDS_pept        177974..178630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99630"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI4"
FT                   /protein_id="ADG99630.1"
FT                   /translation="MMWCAVLVALAVLIWPGNKSGRLYRLAYRGRAVDSAAINEPRYAD
FT                   SPRVGVAQVITSAIARLRGGGTLVEAFEEQSSRRFATHRITVERLITVFEQRRLPDESP
FT                   AQVLEAARGVAAAAVLSDELGCQAVPCLEAVLTAYRQMRLMQNLRSQACAVPKATVGLL
FT                   SALPAVTVALGELLGARPLAFLLGSPRGVVCLTLGGCCYAAGLAWMRALLKGSGL"
     atgatgtggt gtgctgttct ggtggcgctc gccgtgctga tatggccggg gaacaagtcc        60
     gggaggctgt accggctggc ttaccgcggg cgcgcggtcg attccgcagc cataaacgaa       120
     cctcgatatg ccgactcacc tcgcgtgggc gttgcgcagg tgattacgtc cgccatcgcg       180
     cgattgcgag gtggcggcac attggttgaa gcattcgagg aacaatccag cagacgcttc       240
     gccactcatc gcattactgt ggaacggctc ataacggtgt tcgaacagcg gcgtctgccc       300
     gacgaatcac cagcgcaggt acttgaagct gcacgcgggg tcgccgccgc agcggttttg       360
     agcgatgagc tcggttgcca agcggtgcca tgtctggaag cggtattgac tgcttaccgg       420
     cagatgaggc tgatgcagaa cttgcgatcg caagcatgtg ccgttcctaa agccactgtg       480
     gggctgctga gcgcgcttcc ggccgtcact gtggcattgg gcgagcttct gggagctaga       540
     ccattggcgt tcttgcttgg atcgccacgc ggtgtggtct gcctgacatt gggaggatgt       600
     tgttatgctg ccggcttggc atggatgcgg gcattgttga aaggcagcgg attatga          657
//

If you have problems or comments...

PBIL Back to PBIL home page