(data stored in ACNUC30630 zone)

EMBL: CP002010.PE132

CP002010.PE132       Location/Qualifiers
FT   CDS_pept        178627..179229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0138"
FT                   /product="conserved hypothetical membrane protein with
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99631"
FT                   /db_xref="GOA:D6ZXI5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI5"
FT                   /protein_id="ADG99631.1"
FT                   /translation="MSTVWVHAAAGCAAIAGWLYKALSRHDSRLPGEEPAVAHDCGSSW
FT                   TILILRMLQVSLRQGSSIPRALDMVGKAVGGDCGARMSEVGNSLTRGVPWADAWHAAMA
FT                   VQHEGAPADSPSKGNTNTTQRDLGLLQSALESSWTHGDMPGVRLESAIEQLDRDERAAI
FT                   ERNAAKLSVKLLMPTGLCFLPAFVLVGVIPAIASFMM"
     atgagtacgg tgtgggtaca cgccgcggca ggctgtgcgg cgattgctgg ttggctgtat        60
     aaggctctgt ctcgtcatga cagccgcttg ccgggcgagg agccggccgt agcgcatgat       120
     tgcgggtcgt catggaccat actcatattg cgtatgttgc aggtgtcctt gcgtcagggc       180
     tcctcgattc cccgggcgct tgacatggtg ggcaaagccg tcggcggcga ctgcggcgct       240
     cgcatgagcg aggtcgggaa ctccctgacc agaggggttc cctgggctga tgcgtggcat       300
     gccgctatgg ctgttcagca tgagggtgcg ccagctgata gtccatccaa gggaaatacg       360
     aataccacgc aacgagatct tggcctgctg caatcggctt tggaatcgtc atggacgcat       420
     ggcgatatgc ctggtgtgcg cctcgaatcc gccattgaac agctggaccg tgacgagcgt       480
     gctgctatcg aacggaatgc cgcgaagctg tcggtaaagc tactgatgcc tacagggcta       540
     tgttttctgc cggcattcgt gctggtagga gtcattccgg cgattgcgtc cttcatgatg       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page