(data stored in ACNUC30630 zone)

EMBL: CP002010.PE142

CP002010.PE142       Location/Qualifiers
FT   CDS_pept        188782..189348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0148"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99641"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ5"
FT                   /protein_id="ADG99641.1"
FT                   /translation="MTEEEAKSMGDLFPDLGPEAPVISGIAHDRSEALATVRGVPNEPG
FT                   MAAKVFTELATADVNVDMIVQAGASVGTADISFTVPESAVKQVQNTLLDKQEVLGYHSF
FT                   DVNTNVGKVAVVGVGMKTHAGLAAKFFQALSDEGINVLMISTSEIRIAALVPLDQLNDA
FT                   VKALHTAYGLDADQIEAVVYGGTGR"
     atgactgaag aagaagcgaa atccatgggc gacctgttcc ctgacctggg ccccgaggca        60
     ccggtgattt ccggcattgc ccacgatcgt tccgaggcgc tggccaccgt gcgtggcgtg       120
     ccgaacgagc cgggtatggc agccaaggtg ttcaccgagc tggccaccgc cgacgtgaac       180
     gtggacatga tcgtgcaggc cggcgcatcc gttggcactg cggacatctc cttcactgtg       240
     cccgaatcgg ccgtcaagca ggtgcagaac acgctgctcg acaagcagga agtgctgggt       300
     taccactcct ttgatgtgaa caccaacgtc ggcaaggtag ccgtggtggg tgttggcatg       360
     aagacccacg ccggtctggc tgccaagttc ttccaggccc tgagcgatga gggcatcaac       420
     gtgctgatga tttccacttc cgagattcgt atcgccgcac tcgtgccgct cgatcagctc       480
     aacgacgccg tcaaggcgct gcacactgca tacggtctcg atgccgatca gatcgaagcc       540
     gtggtgtacg gcggtactgg ccgctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page