(data stored in ACNUC30630 zone)

EMBL: CP002010.PE156

CP002010.PE156       Location/Qualifiers
FT   CDS_pept        209944..210480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0162"
FT                   /product="GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99655"
FT                   /db_xref="GOA:D6ZXK9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK9"
FT                   /protein_id="ADG99655.1"
FT                   /translation="MKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATISFIISLIFNY
FT                   LASMKFVFKHRDDMARWMEILIFVAGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLL
FT                   RTNIGKLVATAVVMIWNFLIRKWLLDDTHTNAMNRLKSAENRLNAEELEAKWQNSFSHK
FT                   LGIWSLEHTPKGWSK"
     atgaagttcg gcattgtggg cgttatcgcc tttgttatcg actggggtat cctcaaccta        60
     ttggttggca tattccacat gcacaatgtg ctggctgcca ccatctcttt catcatttcg       120
     ctgattttca actatctggc gagcatgaaa ttcgtattca agcatcgtga tgacatggca       180
     cgctggatgg agatccttat cttcgtggcg ggcgctgtag tcggtctgtt catgaatgac       240
     gcgattatct ggatttccac ctatggtatg aaccatgatg cctatgtatc gcagcatgcc       300
     gaatatctgt tgcgcaccaa tatcggcaag ttggtggcca ctgccgtggt aatgatctgg       360
     aacttcttga ttcgcaagtg gctgctcgac gatacgcaca ccaatgcgat gaaccgtctg       420
     aagtccgctg aaaatcgact gaatgccgag gagcttgaag ccaagtggca gaacagcttc       480
     tcccacaagc tcggcatctg gtccttggag cacacgccca aaggctggtc gaagtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page