(data stored in ACNUC30630 zone)

EMBL: CP002010.PE161

CP002010.PE161       Location/Qualifiers
FT   CDS_pept        complement(214965..216071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0167"
FT                   /product="protein of unknown function DUF805"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99660"
FT                   /db_xref="GOA:D6ZXL4"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL4"
FT                   /protein_id="ADG99660.1"
FT                   /translation="MTDPSNAPAPPTPTPNGGPIQHHSGTPEYGAPTAAPAGQDHGRFA
FT                   APASAAQQQPYGQPIYGQPTYGQQEYGQSYGQSAPNANPYAQPSPAYGQVPPTYNQYAA
FT                   PTGAVPLNKPYYGCPFSEAFLRFWQKYTVFRGRASRSEFWWWTLAAVIINALLSLLGDV
FT                   TDGRLDFLTSLWNLAIVVPGLALAVRRLHDTNKPGWWVAVFCGMMTLGLLIMIVGGGAA
FT                   LYGAIGAIGHNYDYGYGYGYEALATGGFGALAIGGLIMLASAVTGIVFMALPSKPEGAR
FT                   FDDDAAIGAAPQNAYGMPYGASAAPGFPAPGTPAQDFGQTVPTYGQNPQYGQNPQQYGQ
FT                   TPQYAPAPQYGQVPPEHENAGPDSGETR"
     atgaccgatc ccagcaacgc gcccgcacca cccacgccca cgcctaacgg cggccccatc        60
     caacaccact caggcacgcc cgaatatgga gcccccaccg cggcgcctgc ggggcaggat       120
     catggtcgtt tcgccgcccc ggcgtcagcg gcgcagcagc aaccctacgg ccagcccatc       180
     tacggccaac ccacctacgg ccagcaggag tatggccagt cctacggcca gtccgctccg       240
     aacgccaatc cctatgccca gccgtccccc gcctacggcc aggttccccc cacctacaac       300
     cagtacgcgg cccccaccgg cgcggtgccg ctgaacaagc cgtactacgg atgccccttc       360
     tccgaagcct tcctccgctt ctggcagaaa tacacggtgt tcaggggacg cgcctcccgc       420
     agtgaattct ggtggtggac gttggccgcc gtcatcatca acgccctgct gtccctgctc       480
     ggcgacgtca cggacggcag gctggacttc ctcaccagcc tgtggaacct ggccatcgtc       540
     gtccccggcc tagcgctcgc cgtccgccgc ctgcacgata cgaacaagcc cggctggtgg       600
     gtcgccgtct tctgcggcat gatgactctg ggactgctca tcatgatcgt cggcggcggc       660
     gcggcgttgt acggcgccat cggcgccatc ggccacaact acgattacgg ttacggctac       720
     ggctatgagg ctctggcaac cggcggcttc ggcgcgttgg ccatcggcgg attgatcatg       780
     ctggccagcg cggtcaccgg cattgtgttc atggccctgc cctccaagcc ggaaggcgca       840
     cggttcgacg acgacgcggc gatcggcgcc gcaccccaaa acgcctacgg tatgccgtac       900
     ggtgcctccg ccgccccggg attcccggct cccggcaccc ccgcccaaga cttcggccag       960
     accgtcccca cgtatgggca gaacccacaa tacgggcaga acccacagca atacgggcag      1020
     actccacaat acgcaccggc cccgcaatac ggccaggtgc cgcccgaaca cgagaacgcc      1080
     ggcccggact ccggcgaaac ccgctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page